Recombinant Full Length Saccharomyces Cerevisiae Peroxisomal Membrane Protein Pex32(Pex32) Protein, His-Tagged
Cat.No. : | RFL5557SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Peroxisomal membrane protein PEX32(PEX32) Protein (P38292) (1-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-413) |
Form : | Lyophilized powder |
AA Sequence : | MDTNSKTKVQTENKKIKAKFIHNHGQKPSLIQITPPMISSTLFHAYPLLLIFDNALANIM WLSDDKCLTFIYLTSIWLTISFFIPVETEASHFLPFTKILRLWLGIISGAFLFLSFMYYI VSLIASLRDTEPPTLDEIVVLLESVLDKLEVLRNELNVWKKLKLSFDGVNKECSGKRLFC RLFLFGTIFQIIIMRYISPGTYTRFFIITGLIYNTSSFQATLRLLWRFTAVRNFYYLGIE SFKISSFLPKHLKMEQIIPLSQGRAITVPLVEVLPKLLRDKKGDDHIHILQLLLNEQKDN FGNEDLKILEIEVYENQRRWYQNKNWSTKLLPYERQNYCIEIKNTDGTLTMRSCLPPDGL GEEELPNNWHWINDNWDGTDWIYSDSAWKEIGQYSSLESFTRSRKWKRRLFHL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PEX32 |
Synonyms | PEX32; YBR168W; YBR1220; Peroxisomal membrane protein PEX32; Peroxin-32 |
UniProt ID | P38292 |
◆ Recombinant Proteins | ||
ABHD14B-75R | Recombinant Rat ABHD14B Protein, His (Fc)-Avi-tagged | +Inquiry |
GADD45GIP1-5852H | Recombinant Human GADD45GIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YRAE-3170B | Recombinant Bacillus subtilis YRAE protein, His-tagged | +Inquiry |
PRG2-45H | Recombinant Human PRG2, GST-tagged | +Inquiry |
CLEC7A-1697H | Recombinant Human CLEC7A protein, hFc-tagged | +Inquiry |
◆ Native Proteins | ||
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
FGF1-26203TH | Native Human FGF1 | +Inquiry |
Hb-001H | Native Human Hb Protein | +Inquiry |
Lectin-1867W | Active Native Succinylated Wheat Germ Agglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTR10-9054HCL | Recombinant Human ACTR10 293 Cell Lysate | +Inquiry |
AP5Z1-359HCL | Recombinant Human AP5Z1 lysate | +Inquiry |
TMEM54-1795HCL | Recombinant Human TMEM54 cell lysate | +Inquiry |
CDC25C-7664HCL | Recombinant Human CDC25C 293 Cell Lysate | +Inquiry |
GSDMD-5725HCL | Recombinant Human GSDMD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PEX32 Products
Required fields are marked with *
My Review for All PEX32 Products
Required fields are marked with *
0
Inquiry Basket