Recombinant Human PRG2, GST-tagged

• Cat.No.: PRG2-45H
• Product Overview: Recombinant Human PRG2(123 a.a. - 222 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 123-222 a.a.
• Description: The protein encoded by this gene is the predominant constituent of the crystalline core of the eosinophil granule. High levels of the proform of this protein are also present in placenta and pregnancy serum, where it exists as a complex with several other proteins including pregnancy-associated plasma protein A (PAPPA), angiotensinogen (AGT), and C3dg. This protein may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions. It is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 36.74 kDa
• AA Sequence: FTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHC VALCTRGGYWRRAHCLRRLPFICSY
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PRG2 proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein) [ Homo sapiens (human) ]
• Official Symbol: PRG2
• Synonyms: PRG2; MBP; BMPG; MBP1; proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein); bone marrow proteoglycan; bone-marrow proteoglycan; proteoglycan 2 preproprotein; natural killer cell activator; eosinophil major basic protein; eosinophil granule major basic protein
• Gene ID: 5553
• mRNA Refseq: NM_001243245
• Protein Refseq: NP_001230174
• MIM: 605601
• UniProt ID: P13727
• Chromosome Location: 11q12
• Pathway: Asthma
• Function: carbohydrate binding; heparin binding