Recombinant Full Length Saccharomyces Cerevisiae Palmitoyltransferase Pfa4(Pfa4) Protein, His-Tagged
Cat.No. : | RFL22911SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Palmitoyltransferase PFA4(PFA4) Protein (Q12006) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW YNDWGESLDDFGVDVDME |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA4 |
Synonyms | PFA4; YOL003C; UNE378; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4 |
UniProt ID | Q12006 |
◆ Native Proteins | ||
Lectin-1721P | Native Peanut Lectin | +Inquiry |
Prothrombin-60H | Native Human Prothrombin Frag 2 | +Inquiry |
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
Prothrombin-270B | Active Native Bovine Prothrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC4-98HCL | Recombinant Human APOC4 cell lysate | +Inquiry |
HAUS2-5629HCL | Recombinant Human HAUS2 293 Cell Lysate | +Inquiry |
NR2C2AP-3712HCL | Recombinant Human NR2C2AP 293 Cell Lysate | +Inquiry |
UCN3-527HCL | Recombinant Human UCN3 293 Cell Lysate | +Inquiry |
NOC4L-3773HCL | Recombinant Human NOC4L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PFA4 Products
Required fields are marked with *
My Review for All PFA4 Products
Required fields are marked with *
0
Inquiry Basket