Recombinant Full Length Saccharomyces Cerevisiae Nuclear Rim Protein 1(Nur1) Protein, His-Tagged
Cat.No. : | RFL14232SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Nuclear rim protein 1(NUR1) Protein (C7GJM5) (1-484aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-484) |
Form : | Lyophilized powder |
AA Sequence : | MGSNDLINEAYDDSEVVGEERESKSAWMKRWYQLLTSPLDLQLVINEKLEMINWDAYAKS LAKPLGNFLTILFFIIRLLQDNLIKPNYYKLNVKSGAFDLSKSNKLKEFDYLWEISSSFQ NSNQFYAFQSWYFVTLRFLNNLFRFTIFILLSLNLYVSCKFMFGYFKTYNLFHLKKEFNS PNLTKHNLKDLSKEYYEDIYKQSLWSMLKHFFRGSRDDGPHVNQNEVEIFFQLRKWIPTN FIINLFVSFSPTAIVFLSFSDVSFTSAIAIVFHQYILDYIITKRFQRSVDDDLILSSAAL QEYEDKHIMARINQCSNIDTLSSAMGTRSKTPRIFTTHSLCGEEIREVYNYEKREFEALP KMTESVPGSRETRIKDYGGISQVSDNQSHPIGFHYSPRMSPYYRDKVLDNNLAQSSSNEN LEKGGAFLPNQDQNRPSKSLSPLRKTPLSARQKRFEGSEFNVLNKNDINSILRSPKKKKN YHKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NUR1 |
Synonyms | NUR1; C1Q_00365; Nuclear rim protein 1 |
UniProt ID | C7GJM5 |
◆ Recombinant Proteins | ||
TFDP2-4494R | Recombinant Rhesus Macaque TFDP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DAZAP1-2357H | Recombinant Human DAZAP1 Protein, GST-tagged | +Inquiry |
SAOUHSC-01374-0110S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01374 protein, His-tagged | +Inquiry |
RFL25863MF | Recombinant Full Length Mouse Zinc Transporter 3(Slc30A3) Protein, His-Tagged | +Inquiry |
OBP2A-136H | Recombinant Human OBP2A protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
S100AA-258B | Native Bovine S-100αα Protein | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
Lectin-1778G | Active Native Galanthus Nivalis Lectin Protein, Fluorescein labeled | +Inquiry |
LDH-35C | Active Native Chicken Lactate dehydrogenase | +Inquiry |
Collagen Type I & III-08R | Native Rat Collagen Type I and III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Rectum-418R | Rat Rectum Membrane Lysate | +Inquiry |
SW620-019WCY | Human Colon Adenocarcinoma SW620 Whole Cell Lysate | +Inquiry |
LDHD-979HCL | Recombinant Human LDHD cell lysate | +Inquiry |
CCL16-7730HCL | Recombinant Human CCL16 293 Cell Lysate | +Inquiry |
HABP2-5649HCL | Recombinant Human HABP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUR1 Products
Required fields are marked with *
My Review for All NUR1 Products
Required fields are marked with *
0
Inquiry Basket