Recombinant Full Length Saccharomyces Cerevisiae Nuclear Control Of Atpase Protein 2(Nca2) Protein, His-Tagged
Cat.No. : | RFL20243SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Nuclear control of ATPase protein 2(NCA2) Protein (Q12374) (1-616aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-616) |
Form : | Lyophilized powder |
AA Sequence : | MIINRRILKSFEEISHSLEESLREVAFDSQQQLIQDVREENEELSRLQDQLQLIRSIVEK ICISIKTDNIDSYCSVPFDLLYNICKDIADPSSFEDGDLQYLVSQAIFEYIILLCYYSVT NECVQGLPAVYEAEQYYKTVSDSILKSFLYCLQNSVSTIRLLSQTVLKDVNKKKLSHQKW SLKALSVDLLEKIRPRINKFMVIRNFRFVGLPKKPIEIASLVSDIPRGIVHERLDMVTQS SKYYTIKLGQLITEFDQQPEENGMFTEVHLPNYERRLKSLQDFFGLAMSDSNLLDVIRCS AKFHKDHPLRRFTKPSILTRYWPSILLCLLYGPSSVMSLWNSRYFIQDFIKTNVVDFAKG LILNWLWAPLKQVWSTVKHDEGSAISVTSQETLNSDMDSLTRMIVSFVVDNSDSTSNSPI DPILLSTKVEHGDLTEFMEIYETQLHHPIKNIATGGLVRSLLIQLQKTKVDGSMALNGID KMLKSQQLVFGVVALSPALVILYSSIVALKRFVKLGNVWSNEKRYREQISISLNNVERVL NYSKQGADADEEHLNQGLLVIEVSNLYKLGSFLIPRSRKKEWFRDVEELVDTNLDSGAHI NVVNRIYHVYGRFLIH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NCA2 |
Synonyms | NCA2; YPR155C; Nuclear control of ATPase protein 2 |
UniProt ID | Q12374 |
◆ Recombinant Proteins | ||
ZFYVE28-2619H | Recombinant Human ZFYVE28 protein, His-tagged | +Inquiry |
CCL7-2955HF | Recombinant Full Length Human CCL7 Protein, GST-tagged | +Inquiry |
TNFSF12-3216H | Recombinant Human TNFSF12 Protein (Asp65-Gln247), His tagged | +Inquiry |
SEMA3F-5831C | Recombinant Chicken SEMA3F | +Inquiry |
GAL3ST1-3307H | Recombinant Human GAL3ST1 Protein (Leu57-Phe196), N-GST tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
CG-76H | Active Native Human Chorionic Gonadotropin (CG) | +Inquiry |
CST3-4309H | Native Human CST3 Protein | +Inquiry |
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAG3L4-635HCL | Recombinant Human STAG3L4 lysate | +Inquiry |
RASAL3-279HCL | Recombinant Human RASAL3 lysate | +Inquiry |
UNG-497HCL | Recombinant Human UNG 293 Cell Lysate | +Inquiry |
NXPH3-3619HCL | Recombinant Human NXPH3 293 Cell Lysate | +Inquiry |
SNRPN-1609HCL | Recombinant Human SNRPN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCA2 Products
Required fields are marked with *
My Review for All NCA2 Products
Required fields are marked with *
0
Inquiry Basket