Recombinant Full Length Oryza Sativa Subsp. Japonica Apocytochrome F(Peta) Protein, His-Tagged
Cat.No. : | RFL30821OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Apocytochrome f(petA) Protein (P0C389) (36-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (36-320) |
Form : | Lyophilized powder |
AA Sequence : | YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLSFQSYRPNKKNILVIGPVPG KKYSEIVFPILSPDPAMKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGVVR KILRKEKGGYEISIVDASDGRQVIDLIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petA |
Synonyms | petA; LOC_Osp1g00480; Nip074; Cytochrome f |
UniProt ID | P0C389 |
◆ Recombinant Proteins | ||
Prnp-800B | Recombinant Bovine Prion Protein (T194A), His-tagged | +Inquiry |
ALOX12-2815H | Recombinant Human ALOX12 protein, His-tagged | +Inquiry |
IL2-306H | Active Recombinant Human IL2, Fc-tagged | +Inquiry |
GMFB-390G | Recombinant Human GMFB Protein (142 aa) | +Inquiry |
XTMA-1729B | Recombinant Bacillus subtilis XTMA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PLE-172P | Active Native Porcine Esterase | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
Avidin-015 | Native Avidin Protein, Peroxidase conjugated | +Inquiry |
ELANE-8236H | Native Human Neutrophil Elastase (ELA-2) | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
◆ Cell & Tissue Lysates | ||
HES4-781HCL | Recombinant Human HES4 cell lysate | +Inquiry |
HAVCR1-2003CCL | Recombinant Cynomolgus HAVCR1 cell lysate | +Inquiry |
STAMBPL1-1426HCL | Recombinant Human STAMBPL1 293 Cell Lysate | +Inquiry |
TPM1-844HCL | Recombinant Human TPM1 293 Cell Lysate | +Inquiry |
ATP6V1H-8573HCL | Recombinant Human ATP6V1H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All petA Products
Required fields are marked with *
My Review for All petA Products
Required fields are marked with *
0
Inquiry Basket