Recombinant Full Length Saccharomyces Cerevisiae Mitochondrial Inner Membrane Magnesium Transporter Mfm1(Mfm1) Protein, His-Tagged
Cat.No. : | RFL14047SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Mitochondrial inner membrane magnesium transporter MFM1(MFM1) Protein (Q02783) (36-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (36-413) |
Form : | Lyophilized powder |
AA Sequence : | FSRQMPKVDPDNTAAMLLQKNLIQRNNMLYGYGSGTIRCTLLDSTGRAKSPLVEIKREDL VSKHGLLPRDLRKIEKSRKNDLVPSLLVRENSILISLLTVKALIKPDMVIIFDSAGSGIT LNSEAHKDFINDMKLRLKNQETSELNSDPLPYEFRALETIFISALSNLTSEMKVLLTICK GVLQDLEFSITRDKLRFLLGQNKKLSSFNKKAVLVKDMLDDLLEQDDMLCDMYLTDKKAG KIRVQDDHTEIEMLLETYHNYVDEIVQKSESAISDVKTTEEIINIILDSNRNELMLLGIR YAIGMLSLGGALFLGSIYGMNLESFIEESNYAYLTVTILGLISTVWLYAKGIRHLHKLQR MTLLSKIKTDSVHELLKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MFM1 |
Synonyms | MFM1; LPE10; YPL060W; Mitochondrial inner membrane magnesium transporter MFM1; MRS2 function modulating factor 1 |
UniProt ID | Q02783 |
◆ Recombinant Proteins | ||
ZFYVE19-549Z | Recombinant Zebrafish ZFYVE19 | +Inquiry |
RFL20807HF | Recombinant Full Length Human Claudin-17(Cldn17) Protein, His-Tagged | +Inquiry |
TP53INP1-6233R | Recombinant Rat TP53INP1 Protein | +Inquiry |
PSMB9-3497H | Recombinant Human PSMB9, His-tagged | +Inquiry |
RFL23785NF | Recombinant Full Length Neurospora Crassa V-Type Proton Atpase 16 Kda Proteolipid Subunit 2(Vma-11) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HSV2Ag-355H | Active Native Herpes Simplex Virus 2 Protein | +Inquiry |
Lectin-1778G | Active Native Galanthus Nivalis Lectin Protein, Fluorescein labeled | +Inquiry |
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
COL6-116H | Native Human Collagen type VI | +Inquiry |
Prothrombin-271B | Active Native Bovine Prothrombin Frag 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LINC00521-8275HCL | Recombinant Human C14orf48 293 Cell Lysate | +Inquiry |
MMP3-4273HCL | Recombinant Human MMP3 293 Cell Lysate | +Inquiry |
KCTD17-5006HCL | Recombinant Human KCTD17 293 Cell Lysate | +Inquiry |
ANKRD13D-8856HCL | Recombinant Human ANKRD13D 293 Cell Lysate | +Inquiry |
SPI1-1683HCL | Recombinant Human SPI1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MFM1 Products
Required fields are marked with *
My Review for All MFM1 Products
Required fields are marked with *
0
Inquiry Basket