Recombinant Full Length Saccharomyces Cerevisiae Methylsterol Monooxygenase(Erg25) Protein, His-Tagged
Cat.No. : | RFL17943SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Methylsterol monooxygenase(ERG25) Protein (P53045) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MSAVFNNATLSGLVQASTYSQTLQNVAHYQPQLNFMEKYWAAWYSYMNNDVLATGLMFFL LHEFMYFFRCLPWFIIDQIPYFRRWKLQPTKIPSAKEQLYCLKSVLLSHFLVEAIPIWTF HPMCEKLGITVEVPFPSLKTMALEIGLFFVLEDTWHYWAHRLFHYGVFYKYIHKQHHRYA APFGLSAEYAHPAETLSLGFGTVGMPILYVMYTGKLHLFTLCVWITLRLFQAVDSHSGYD FPWSLNKIMPFWAGAEHHDLHHHYFIGNYASSFRWWDYCLDTESGPEAKASREERMKKRA ENNAQKKTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG25 |
Synonyms | ERG25; FET6; YGR060W; Methylsterol monooxygenase; C-4 methylsterol oxidase; Sterol-C4-methyl oxidase |
UniProt ID | P53045 |
◆ Recombinant Proteins | ||
AFAP1-400H | Recombinant Human AFAP1 Protein, GST-tagged | +Inquiry |
USP18-149H | Recombinant Human USP18 Protein, His tagged | +Inquiry |
GTF2B-30662TH | Recombinant Human GTF2B | +Inquiry |
CTLA4-862H | Recombinant Human CTLA4 protein, His-tagged, low endotoxin | +Inquiry |
GABARAP-3465H | Recombinant Human GABARAP Protein (Met1-Gln116), N-His and C-Fc tagged | +Inquiry |
◆ Native Proteins | ||
FGB-59R | Native Rabbit Fibrinogen | +Inquiry |
Collagen-60H | Native Human Collagen Type II | +Inquiry |
SERPINA3-8008H | Native Human Serum Alpha 1-AntiChymoTrypsin | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
Tryptase-01H | Active Native Human Tryptase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A39-1763HCL | Recombinant Human SLC25A39 293 Cell Lysate | +Inquiry |
SLTM-1641HCL | Recombinant Human SLTM cell lysate | +Inquiry |
ZMIZ1-154HCL | Recombinant Human ZMIZ1 293 Cell Lysate | +Inquiry |
CC2D1A-7799HCL | Recombinant Human CC2D1A 293 Cell Lysate | +Inquiry |
PAPD4-1281HCL | Recombinant Human PAPD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERG25 Products
Required fields are marked with *
My Review for All ERG25 Products
Required fields are marked with *
0
Inquiry Basket