Recombinant Full Length Saccharomyces Cerevisiae Low-Affinity Fe(2+) Transport Protein Protein, His-Tagged
Cat.No. : | RFL2928SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Low-affinity Fe(2+) transport protein Protein (P40988) (1-552aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-552) |
Form : | Lyophilized powder |
AA Sequence : | MGKIAEFLGNPGARPDVHHRAPTVDCKQYEEFGDSNDYKNDDVVRVVSHSDESTDDELCN VNLTETGAIFTSKGFTGLSKGFTDKTLDFLVRVAGSQAVFFIVWIILIIWVVIGIVYNAP FNWQVVMQDGQSIQSYVWDTLLMRQQLMSTHEQILICGRLKSRLASFKNYLTRSTPEEEK ADCTVEANEVSSVENHIDPSAINGELPVENWYDRLSNVASRYMGSIAAMVIFWIGIFVWI GCGAIPKDAGNTPPYTGETTGSNPRLKKFSDAWQMYINTAVAVSLLICTTFLQNIRARHD YFTGRFLVDIFDMDEKIDYRIRKHFNDFETPHPVVTIESKKRSTGRKMIDWYADIIGTGI GVLIGVAVFATWIGIGSPMKWDDNWWLIIGTYTGLIGFLDGFVLREVYFRIVQHEEKNYS DVAKEDLELFQELGIECPEEFSGKAPEINTIGYRTSQYINRICSTPWSVLVSVIIIIGLI CIASGLRWSTTGQLIANTPTMIIEEFFLLVLLQAHNWADRQRRVEVTALYARRRILLSYV EKRFPEVMMLEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FET4 |
Synonyms | FET4; YMR319C; YM9924.11C; Low-affinity Fe(2+ transport protein; Low-affinity Fe(II transport protein |
UniProt ID | P40988 |
◆ Native Proteins | ||
CP-5326H | Native Human Ceruloplasmin (ferroxidase) | +Inquiry |
HSV1-15 | Native Herpes Simplex Virus (HSV) Type 1 Antigen | +Inquiry |
F10-26055TH | Native Human F10 | +Inquiry |
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
Proteoglycans-54B | Native Bovine Proteoglycans | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEF1-4778HCL | Recombinant Human LEF1 293 Cell Lysate | +Inquiry |
PKN3-3149HCL | Recombinant Human PKN3 293 Cell Lysate | +Inquiry |
Y-79-1942H | Y-79 (human retinoblastoma) nuclear extract lysate | +Inquiry |
C1orf187-8170HCL | Recombinant Human C1orf187 293 Cell Lysate | +Inquiry |
KCNK15-224HCL | Recombinant Human KCNK15 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FET4 Products
Required fields are marked with *
My Review for All FET4 Products
Required fields are marked with *
0
Inquiry Basket