Recombinant Full Length Saccharomyces Cerevisiae Inheritance Of Peroxisomes Protein 2(Inp2) Protein, His-Tagged
Cat.No. : | RFL13805SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Inheritance of peroxisomes protein 2(INP2) Protein (A6ZMM2) (1-705aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-705) |
Form : | Lyophilized powder |
AA Sequence : | MTTNSRPSALQAPGLQIFSMLKSSEEDGFMSSSLTLDSDNIIGVTENNRQEFYSTWRKPS LLSSRSVLHEYSPTIVGSNDSTFSPITVGKTTKFFNWDDIISRIFMQQPFGVTHQFFEEF RYSIITSHFLNDMNHYRLSLHLDQSIMNFHKSSTLLKNVPPKSVPFMATKYGKLAVVEDK KLYFRQNFNYLSMIITSYRVLTQLKKYCRRKNSPGLKRVVILILVAVYLSIQQEYFRRHL ICYKTLLKVRKVLESLQQVDVMIHKYHLRFKEIKNHSFISRVSLISIADEHSSVIKELLV FSSDALFYKLKSIIPDIVIFSDTSELSKYCELYGIDVPNLYYNNTTTVKDLDGKLYRLKL LKKFMLCCLLSLDMAGNENLSNVNMRNALNKIFPDYMARVQLKKKYNPIGTFQNIVSLLR GLHSLLSTVLVSLNDHKQILYAFPEETSTNTGCERANVCSFSKNDKLFQALNYLKMIENN LLAIDIRNGITENDRNIIEDKLEELITFWKTSKICGNISRIQKVSPTNTINHGFHLDILK GRKSPRSSSVQGLSLERKVDFIDVAESVNDSFENDTELEEYEDYDCQEECSAGSRQNHRV DFIGKDNCRKPDFKQLSDNELRRKLDERILKLAQENREGRERLRTAKSFELLRKAQASMS VKFGFQKPLRDDAFLESRPLSKCKVSSEETIPFLYELKGLLGNDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | INP2 |
Synonyms | INP2; SCY_4338; Inheritance of peroxisomes protein 2 |
UniProt ID | A6ZMM2 |
◆ Recombinant Proteins | ||
TTLL2-9740M | Recombinant Mouse TTLL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZC2HC1C-6650R | Recombinant Rat ZC2HC1C Protein | +Inquiry |
TRPM6-4248H | Recombinant Human TRPM6 Protein, His (Fc)-Avi-tagged | +Inquiry |
RXRB-1154H | Active Recombinant Full Length Human Retinoid X Receptor, Beta, GST-tagged | +Inquiry |
RFL2055GF | Recombinant Full Length Gulo Gulo Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
Protein S-90H | Native Human Protein S | +Inquiry |
ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
C3-001C | Active Native C. botulinum C3 Enzyme | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLEKHA8-3115HCL | Recombinant Human PLEKHA8 293 Cell Lysate | +Inquiry |
LTA4H-731HCL | Recombinant Human LTA4H cell lysate | +Inquiry |
ASMTL-136HCL | Recombinant Human ASMTL cell lysate | +Inquiry |
C21orf62-8097HCL | Recombinant Human C21orf62 293 Cell Lysate | +Inquiry |
RTKN-2124HCL | Recombinant Human RTKN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INP2 Products
Required fields are marked with *
My Review for All INP2 Products
Required fields are marked with *
0
Inquiry Basket