Recombinant Full Length Saccharomyces Cerevisiae Increased Recombination Centers Protein 18(Irc18) Protein, His-Tagged
Cat.No. : | RFL4831SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Increased recombination centers protein 18(IRC18) Protein (P47056) (1-224aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-224) |
Form : | Lyophilized powder |
AA Sequence : | MKVQMIERIFLIQLCLLTVVLASSRAVVEFESTGTKLVNSLRVLAAYSQSSVCVDEKISG IERQIEEVKDMYGNHSFILKGLNGILNNKVNMLTREIQMETVGNNTFETETGKLTKGLNR AVNISPFKYIKKFKTVSTKKFESLLNKYDLVAKKGGELTEEQKKKKEVLSRISRVVAATT IEAGLAQGVVDLCITVTTSLCLVSASIGGVGFLIWLTIIYQALT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IRC18 |
Synonyms | IRC18; OSW6; YJL037W; J1234; Outer spore wall protein 6; Increased recombination centers protein 18 |
UniProt ID | P47056 |
◆ Native Proteins | ||
PLE-105P | Active Native Porcine Esterase | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
HDLBP-86H | Native Human Lipoproteins | +Inquiry |
CTSB-26408TH | Native Human CTSB | +Inquiry |
IgG-166R | Native Rat IgG Fc fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSGEPL1-1261HCL | Recombinant Human OSGEPL1 cell lysate | +Inquiry |
PKIB-3157HCL | Recombinant Human PKIB 293 Cell Lysate | +Inquiry |
B3GALT1-8549HCL | Recombinant Human B3GALT1 293 Cell Lysate | +Inquiry |
UBL5-552HCL | Recombinant Human UBL5 293 Cell Lysate | +Inquiry |
UIMC1-506HCL | Recombinant Human UIMC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All IRC18 Products
Required fields are marked with *
My Review for All IRC18 Products
Required fields are marked with *
0
Inquiry Basket