Recombinant Full Length Saccharomyces Cerevisiae Glutathione Transferase 3(Gtt3) Protein, His-Tagged
Cat.No. : | RFL16070SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Glutathione transferase 3(GTT3) Protein (P39996) (1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-337) |
Form : | Lyophilized powder |
AA Sequence : | MPTKSTFSRWKKADLIDLANKLEIDGFPNYAKKSDMIDYLESHLNHLEKPVDFKDDYPEL RSFYESMTVDQSKDERNEYGSGSGNGSGSGSCDTATNDSDLEKAYIKEDDDEKPQSGDET SATKPLSSRNANSNAKTNFNLLDFSTDNDSSTSAFTKFKFNFQEYLSDIRYQTQKLNENV QDYLSTISAVDTIFSLLEFSFLVRNILAAGQPTSSSSLASSLEAAVAAHNKYQYTLDFCL PILTWLLFFRGIPTLVSYYINFIRYDLNIELDPMTFNLTKFLISLAIFKTCNNKNIDFHS FRCVNQLWTQLCTVNRSLGMVPLVFSMVSCLLTLYVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GTT3 |
Synonyms | GTT3; YEL017W; Glutathione transferase 3 |
UniProt ID | P39996 |
◆ Recombinant Proteins | ||
Snrpa-6004M | Recombinant Mouse Snrpa Protein, Myc/DDK-tagged | +Inquiry |
UBE2G1-3534H | Recombinant Human UBE2G1, GST-tagged | +Inquiry |
RFL23798SF | Recombinant Full Length Synechocystis Sp. Uncharacterized Protein Slr0272 (Slr0272) Protein, His-Tagged | +Inquiry |
NT5C2-257H | Recombinant Human NT5C2 protein, MYC/DDK-tagged | +Inquiry |
TAPBP-122H | Recombinant Human TAPBP Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
BSI-B4-852 | Active Native Bandeiraea simplicifolia Isolectin B4 protein | +Inquiry |
CDA016 | Native Hepatitis B Surface Ag protein | +Inquiry |
IGHG4 -23H | Native Human IgG4 | +Inquiry |
Bcl2a1b-5322M | Native Mouse B-Cell Leukemia/Lymphoma 2 Related Protein A1b | +Inquiry |
Small Intestine-014H | Human Small Intestine Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPO3-1906HCL | Recombinant Human RSPO3 cell lysate | +Inquiry |
MAP3K5-4504HCL | Recombinant Human MAP3K5 293 Cell Lysate | +Inquiry |
PPIG-1396HCL | Recombinant Human PPIG cell lysate | +Inquiry |
TNFRSF11B-1183CCL | Recombinant Cynomolgus TNFRSF11B cell lysate | +Inquiry |
TMEM81-929HCL | Recombinant Human TMEM81 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GTT3 Products
Required fields are marked with *
My Review for All GTT3 Products
Required fields are marked with *
0
Inquiry Basket