Recombinant Full Length Saccharomyces Cerevisiae Fit Family Protein Scs3(Scs3) Protein, His-Tagged
Cat.No. : | RFL16806SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae FIT family protein SCS3(SCS3) Protein (P53012) (1-380aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-380) |
Form : | Lyophilized powder |
AA Sequence : | MSSKWFNAIHLLVCPLTVLVGYLMNAYGYGAALQATLNKDGLVNAMLVKKGWFWTSLVGW WCIIRYRAVPGATGRDRRHIVQSFKRYAILTVWWYVFTQGIWFGVGPIMDLVFVYTGGHC HYDVFDDAGHVNEDFQGSVTRTNRALALIHNVLTLHGHHQEHRQQQLWDRSIGSIQGALQ ATQPKTPKNVTASAAAAINTFIHDQMHRWQGPLTTSAQCRRFGGHWAGGHDPSGHVFLAT LMCMFLLGELRVFGRRALAHLYAQKWQLVRLVTRLFDTGPLWTWRRCGGGSMTCGARLWR AIVEPPVTCAAALLRLTRCIACDHPVIILLTLLVTWLWQLLLTAVASRFHTVREHMSGLL AAYIVTGLVYARDAAALRPV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SCS3 |
Synonyms | SCS3; FIT2B; YGL126W; G2868; Acyl-coenzyme A diphosphatase SCS3; FIT family protein SCS3 |
UniProt ID | P53012 |
◆ Native Proteins | ||
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
CRP-8056H | Native Human C-Reactive Protein | +Inquiry |
ACTN1-162C | Native chicken ACTN1 | +Inquiry |
Fibrinogen-7589H | Native Human Fibrinogen | +Inquiry |
SERPIND1-12H | Native Human Heparin Cofactor II | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF69-27HCL | Recombinant Human ZNF69 293 Cell Lysate | +Inquiry |
C22orf13-8094HCL | Recombinant Human C22orf13 293 Cell Lysate | +Inquiry |
ZNF165-138HCL | Recombinant Human ZNF165 293 Cell Lysate | +Inquiry |
CEP57L1-124HCL | Recombinant Human CEP57L1 lysate | +Inquiry |
ANAPC16-8866HCL | Recombinant Human ANAPC16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCS3 Products
Required fields are marked with *
My Review for All SCS3 Products
Required fields are marked with *
0
Inquiry Basket