Recombinant Full Length Saccharomyces Cerevisiae Ferric Reductase Transmembrane Component 5(Fre5) Protein, His-Tagged
Cat.No. : | RFL30691SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Ferric reductase transmembrane component 5(FRE5) Protein (Q08908) (20-694aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-694) |
Form : | Lyophilized powder |
AA Sequence : | KPASTKKRTQWDQIAIDACAKELESHKFDTDVKGRHATLCTYEPALGSWLHCAKDVLDSR KKSKKIFEKTFSKINQYCHDYHKDEVVSNEEYYRIFANASLFIRPLDEVKENIRYPVTPN KASLDRWVWAYFGPLDNIDKGNVYGVTICLYWIGVLFIAAVYHFLNFSRLKQTVFKNKVS AFLRGHYVLPALVHNHAMSVGRWFFIGLVPTRLETLVLFGYVLLHGFLLSSYNFDHNELL SDRRSQVLIFLSDRAGILAFAHFPLIVLFGGKNSTMTWLTGIRYTAFITYHKWLGRFMLV DCTIHAIGYTYHAYIENYWKYVKYSDLWTSGRHAMIIVGILVFFSFFFFRRHYYELFVIT HIILAIGFFHACWKHCYKLGWGEWIMACALFWIADRILRLIKIAIFGMPWAKLKLCGESM IEVRISKSSKWWKAEPGQYIYLYFLRPKIFWQSHPFTVMDSLVEDGELVVVITVKNGLTK KLQEYLLESEGYTEMRVLAEGPYGQSTRTHLFESLLFIAGGAGVPGPLSMAIKAGRQVKS NDSHQMIKFVWSVRNLDLLEVYRKEIMVLKELNIDTKIYFTGERKDESNTEEGAIANMST EGRLLTTSKSAEMITDFGRPNIDEIIEEAVSGAKSLLVTCCGSEGFVDKTRELTAKRVLE HGDKWIEYVEEFQNW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FRE5 |
Synonyms | FRE5; YOR384W; O6765; Ferric reductase transmembrane component 5; Ferric-chelate reductase 5 |
UniProt ID | Q08908 |
◆ Recombinant Proteins | ||
KANSL3-3152R | Recombinant Rat KANSL3 Protein | +Inquiry |
FGFR1-03H | Recombinant Human fibroblast growth factor receptor 1 Protein, His tagged | +Inquiry |
COTF-0360B | Recombinant Bacillus subtilis COTF protein, His-tagged | +Inquiry |
CD28-747HB | Recombinant Human CD28 protein, His-Avi-tagged, Biotinylated | +Inquiry |
UFD1L-9876M | Recombinant Mouse UFD1L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-238R | Native Rabbit Immunoglobulin A | +Inquiry |
FABP3-09M | Native Mouse FABP3 protein | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
Collagen-57H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST11-7227HCL | Recombinant Human CST11 293 Cell Lysate | +Inquiry |
C9orf156-7940HCL | Recombinant Human C9orf156 293 Cell Lysate | +Inquiry |
RGS5-2371HCL | Recombinant Human RGS5 293 Cell Lysate | +Inquiry |
GYPE-5671HCL | Recombinant Human GYPE 293 Cell Lysate | +Inquiry |
B4GALT2-8539HCL | Recombinant Human B4GALT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FRE5 Products
Required fields are marked with *
My Review for All FRE5 Products
Required fields are marked with *
0
Inquiry Basket