Recombinant Full Length Saccharomyces Cerevisiae Ferric Reductase Transmembrane Component 4(Fre4) Protein, His-Tagged
Cat.No. : | RFL33545SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Ferric reductase transmembrane component 4(FRE4) Protein (P53746) (19-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-719) |
Form : | Lyophilized powder |
AA Sequence : | KAPPSKTSLINTHERRSIYSCYVGLRKETWGFNGSAICRYEPAIQSMLYCLYEDTHEKGY SNKTLEKGFEEMRQFCYTPKFLNMTDAEFYTSLDNGTYYIQDQPKAGINITYPIRLNTTL RKAYYDAYYGYYYNHDIPYYFGGIICAYFVGVMLLAGLIRFLNYTPIKKIMFQQKLVNYV RGYTTLPTLYEKHAEPFSYLKVITGYLPTRFETLVILGYLILHTIFMAYKYQYDPYHIIF AAHRAEVAHFVAYRSGILSFAHLPLIVLFAGRNNFLQLISGLKHTSFIVFHKWLGRMMFL DAIIHAAGFTNYYLYYKKWNTVRLRVYWKFGIATTCLAGMLIFFSIAAFRRHYYETFMAL HIVFAALFLYTCWEHVTNFSGIEWIYAAIAIWGVDRIVRITRIALLGFPKADLQLVGSDL VRVTVKKPKKFWKAKPGQYVFVSFLRPLCFWQSHPFTVMDSCVNDRELVIVLKAKKGVTK LVRNFVERKGGKASMRLAIEGPYGSKSTAHRFDNVLLLAGGSGLPGPISHALELGKTTAA SGKNFVQLVIAVRGLDMLNACKKELMALKGLNVQVHIYNSKQELASAEKISSNEVKNGET TAEKAPSSLSNSEKAPSESENTELPLSLNDTSISDLEFATFHVGRPNVEEILNESVNHSG SLAVVCCGPPIFVDTARNQTAKAVIRNPSRMIEYLEEYQAW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FRE4 |
Synonyms | FRE4; YNR060W; N3518; Ferric reductase transmembrane component 4; Ferric-chelate reductase 4 |
UniProt ID | P53746 |
◆ Recombinant Proteins | ||
NI36-RS11135-1000S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS11135 protein, His-tagged | +Inquiry |
AF1521-2757P | Recombinant Pan-species (General) AF1521 Protein, His/SUMO-tagged | +Inquiry |
SREBF2-3652H | Recombinant Human SREBF2 protein, His-tagged | +Inquiry |
MALA-0126B | Recombinant Bacillus subtilis MALA protein, His-tagged | +Inquiry |
RB1CC1-3802R | Recombinant Rhesus monkey RB1CC1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-250M | Native Monkey Immunoglobulin A | +Inquiry |
PLE-172P | Active Native Porcine Esterase | +Inquiry |
HP-200H | Native Human Haptoglobin | +Inquiry |
Pla2-85A | Active Native Apis mellifera Phospholipase A2 | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPBT-56409RH | Rabbit Anti-Human PDCD4 Polyclonal Antibody | +Inquiry |
CHMP2B-185HCL | Recombinant Human CHMP2B lysate | +Inquiry |
DAPK1-602HCL | Recombinant Human DAPK1 cell lysate | +Inquiry |
C8orf22-7954HCL | Recombinant Human C8orf22 293 Cell Lysate | +Inquiry |
IFNA5-2932HCL | Recombinant Human IFNA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FRE4 Products
Required fields are marked with *
My Review for All FRE4 Products
Required fields are marked with *
0
Inquiry Basket