Recombinant Full Length Saccharomyces Cerevisiae Ferric/Cupric Reductase Transmembrane Component 7(Fre7) Protein, His-Tagged
Cat.No. : | RFL34396SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Ferric/cupric reductase transmembrane component 7(FRE7) Protein (Q12333) (1-620aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-620) |
Form : | Lyophilized powder |
AA Sequence : | MIEERDLVLSNGIHCIADIHSELYARLKKESQAATPWVYQKQYGKFVTYFVAVIIFLSLI KKLAFMYYDSSEEFLPEKKNSPTTPSVFLARIMTKLVAFNRYICYRKFPTLIFSYLGIPT SVGTFLVVMATTLYTLLYCFVPHPFYRPCAGFGSPPLSVRAGIMAISLVPFVFSLSGKIN VIGWLVGLSYEKINIYHQWASILCLFFSWVHVIPFLRQARHEGGYERMHQRWKASDMWRS GVPPILFLNLLWLSSLPIARRHFYEIFLQLHWILAVGFYISLFYHVYPELNSHMYLVATI VVWFAQLFYRLAVKGYLRPGRSFMASTIANVSIVGEGCVELIVKDVEMAYSPGQHIFVRT IDKGIISNHPFSIFPSAKYPGGIKMLIRAQKGFSKRLYESNDDMKKILIDGPYGGIERDI RSFTNVYLICSGSGISTCLPFLQKYGPILHKTNLEVITLDWVVRHREDISWIRDEMCTLS NNLRQLFLDGKIVVRIYVCSDSTVPGIIKTFPQTIDTASDQSDLAKREKDTEFGQDDTES NSTFDKSNNEYKGLITIIPSKPDLNQVINDYQIGFRNCFICSGSDSLRYTVGNSVAGLQA KVFSNKNVEECYLHSESFGY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FRE7 |
Synonyms | FRE7; YOL152W; AOB629; Ferric/cupric reductase transmembrane component 7; Ferric-chelate reductase 7 |
UniProt ID | Q12333 |
◆ Native Proteins | ||
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
TF-31158TH | Native Human TF | +Inquiry |
Lectin-1732D | Active Native Dolichos Biflorus Agglutinin Protein, Rhodamine labeled | +Inquiry |
Collagen-57H | Native Human Collagen Type II | +Inquiry |
Lectin-1830R | Active Native Ricinus Communis Agglutinin I Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFTUD2-6698HCL | Recombinant Human EFTUD2 293 Cell Lysate | +Inquiry |
XCL1-452CCL | Recombinant Cynomolgus XCL1 cell lysate | +Inquiry |
DMKN-1968HCL | Recombinant Human DMKN cell lysate | +Inquiry |
DDX24-7013HCL | Recombinant Human DDX24 293 Cell Lysate | +Inquiry |
TINAG-1062HCL | Recombinant Human TINAG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FRE7 Products
Required fields are marked with *
My Review for All FRE7 Products
Required fields are marked with *
0
Inquiry Basket