Recombinant Full Length Saccharomyces Cerevisiae Delta(24(24(1)))-Sterol Reductase Protein, His-Tagged
Cat.No. : | RFL3761SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Delta(24(24(1)))-sterol reductase Protein (P25340) (1-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-473) |
Form : | Lyophilized powder |
AA Sequence : | MAKDNSEKLQVQGEEKKSKQPVNFLPQGKWLKPNEIEYEFGGTTGVIGMLIGFPLLMYYM WICAEFYHGKVALPKAGESWMHFIKHLYQLVLENGIPEKYDWTIFLTFWVFQIIFYYTLP GIWTKGQPLSHLKGKQLPYFCNAMWTLYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTCAI ISGFAFSIILYLWTLFISHDYHRMTGNHLYDFFMGAPLNPRWGILDLKMFFEVRLPWFTL YFITLGACLKQWETYGYVTPQLGVVMLAHWLYANACAKGEELIVPTWDMAYEKFGFMLIF WNIAGVPYTYCHCTLYLYYHDPSEYHWSTLYNVSLYVVLLCAYYFFDTANAQKNAFRKQM SGDKTGRKTFPFLPYQILKNPKYMVTSNGSYLLIDGWYTLARKIHYTADWTQSLVWALSC GFNSVFPWFFPVFFLVVLIHRAFRDQAKCKRKYGKDWDEYCKHCPYVFIPYVF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG4 |
Synonyms | ERG4; YGL012W; YGL022; Delta(24(24(1-sterol reductase; C-24(28 sterol reductase; Sterol Delta(24(28-reductase |
UniProt ID | P25340 |
◆ Recombinant Proteins | ||
PXMP2-3717R | Recombinant Rhesus monkey PXMP2 Protein, His-tagged | +Inquiry |
RFL2705BF | Recombinant Full Length Bradyrhizobium Japonicum Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
gag-725V | Recombinant HIV gag Protein, His-tagged | +Inquiry |
DIAPH3-1049Z | Recombinant Zebrafish DIAPH3 | +Inquiry |
Spike-238V | Active Recombinant COVID-19 Spike protein S2, His-tagged | +Inquiry |
◆ Native Proteins | ||
LIPO-02E | Native Escherichia coli Lipopolysaccharides | +Inquiry |
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
YIgG-138C | Native Chicken Yolk Immunoglobulin | +Inquiry |
LDL-404H | Native Human Low Density Lipoprotein, Oxidized, Biotin labeled | +Inquiry |
ALB-108C | Native Cynomolgus Monkey Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCLRE1B-7050HCL | Recombinant Human DCLRE1B 293 Cell Lysate | +Inquiry |
FKBP1A-6210HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
C21orf34-8102HCL | Recombinant Human C21orf34 293 Cell Lysate | +Inquiry |
DNAJC10-6880HCL | Recombinant Human DNAJC10 293 Cell Lysate | +Inquiry |
ABCF2-9144HCL | Recombinant Human ABCF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERG4 Products
Required fields are marked with *
My Review for All ERG4 Products
Required fields are marked with *
0
Inquiry Basket