Recombinant Full Length Saccharomyces Cerevisiae Cytochrome Oxidase Assembly Protein 3, Mitochondrial(Coa3) Protein, His-Tagged
Cat.No. : | RFL22160SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Cytochrome oxidase assembly protein 3, mitochondrial(COA3) Protein (C8ZBF1) (1-85aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-85) |
Form : | Lyophilized powder |
AA Sequence : | MVLNPSKYQDTRTWKMTPAMIRARKPFFKGNMLGLTLLLGVTGSVYYYTYHFLHKDNDFA DVPIPPIDPQELEALKKEYEAKKKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COA3 |
Synonyms | COA3; COX25; RRG10; EC1118_1J11_1893g; Cytochrome c oxidase assembly factor 3, mitochondrial; Cytochrome c oxidase protein 25; Required for respiratory growth protein 10 |
UniProt ID | C8ZBF1 |
◆ Cell & Tissue Lysates | ||
COA3-7759HCL | Recombinant Human CCDC56 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COA3 Products
Required fields are marked with *
My Review for All COA3 Products
Required fields are marked with *
0
Inquiry Basket