Recombinant Full Length Saccharomyces Cerevisiae Cobalt Uptake Protein Cot1(Cot1) Protein, His-Tagged
Cat.No. : | RFL9134SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Cobalt uptake protein COT1(COT1) Protein (P32798) (1-439aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-439) |
Form : | Lyophilized powder |
AA Sequence : | MKLGSKQVKIISLLLLDTVFFGIEITTGYLSHSLALIADSFHMLNDIISLVVALWAVNVA KNRNPDSTYTYGWKRAEILGALINAVFLIALCVSILIEALQRIIAPPVIENPKFVLYVGV AGLISNTVGLFLFHDNDQEHGHGHGHSHGGIFADHEMHMPSSHTHTHAHVDGIENTTPMD STDNISEIMPNAIVDSFMNENTRLLTPENASKTPSYSTSSHTIASGGNYTEHNKRKRSLN MHGVFLHVLGDALGNIGVMLSAFFIWKTDYSWKYYTDPLVSLIITGIIFSSALPLSCKAS KILLQATPSTLSGDQVEGDLLKIPGIIAIHDFHIWNLTESIFIASLHIQLDISPEQFTDL AKIVRSKLHRYGIHSATLQPEFITREVTSTERAGDSQGDHLQNDPLSLRPKTYGTGISGS TCLIDDAANCNTADCLEDH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COT1 |
Synonyms | COT1; YOR316C; O6131; Cobalt uptake protein COT1 |
UniProt ID | P32798 |
◆ Recombinant Proteins | ||
Ceacam1-3312MAF555 | Recombinant Mouse Ceacam1 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
IL21R-340H | Recombinant Human IL21R, Fc-tagged | +Inquiry |
ESP16.9-1329R | Recombinant Rhesus Macaque ESP16.9 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDK10-3177HF | Recombinant Full Length Human CDK10 Protein, GST-tagged | +Inquiry |
TTC32-4829R | Recombinant Rhesus Macaque TTC32 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Glycogen-006B | Native Bovine or Rabbit Glycogen | +Inquiry |
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
GPDH-119R | Active Native Rabbit Glycerol-3-phosphate Dehydrogenase | +Inquiry |
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
AMY1A-5313H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI27L1-5295HCL | Recombinant Human IFI27L1 293 Cell Lysate | +Inquiry |
ANKRD54-8846HCL | Recombinant Human ANKRD54 293 Cell Lysate | +Inquiry |
CTDSP1-7210HCL | Recombinant Human CTDSP1 293 Cell Lysate | +Inquiry |
RAB17-2626HCL | Recombinant Human RAB17 293 Cell Lysate | +Inquiry |
BATF-155HCL | Recombinant Human BATF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All COT1 Products
Required fields are marked with *
My Review for All COT1 Products
Required fields are marked with *
0
Inquiry Basket