Recombinant Full Length Saccharomyces Cerevisiae Cdp-Diacylglycerol--Inositol 3-Phosphatidyltransferase(Pis1) Protein, His-Tagged
Cat.No. : | RFL34492SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae CDP-diacylglycerol--inositol 3-phosphatidyltransferase(PIS1) Protein (P06197) (1-220aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-220) |
Form : | Lyophilized powder |
AA Sequence : | MSSNSTPEKVTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDG TMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMYA SLSAGKTSHKSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSNSATFGKWTT IISFPGYVFKQTANVVQLKRAALILADNDAKNANEKNKTY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PIS1 |
Synonyms | PIS1; PIS; YPR113W; P8283.5; CDP-diacylglycerol--inositol 3-phosphatidyltransferase; Phosphatidylinositol synthase; PI synthase; PtdIns synthase |
UniProt ID | P06197 |
◆ Recombinant Proteins | ||
ZNHIT3-10487M | Recombinant Mouse ZNHIT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Por-3358M | Recombinant Mouse Por protein, His&Myc-tagged | +Inquiry |
RFL5000CF | Recombinant Full Length Clostridium Novyi Upf0059 Membrane Protein Nt01Cx_1560 (Nt01Cx_1560) Protein, His-Tagged | +Inquiry |
CPNE2-2099HF | Recombinant Full Length Human CPNE2 Protein, GST-tagged | +Inquiry |
COMT-27960TH | Recombinant Human COMT | +Inquiry |
◆ Native Proteins | ||
ORM1-8016R | Native Rabbit Serum Alpha-1-Acid GlycoProtein | +Inquiry |
IgG-118H | Native Horse Immunoglobulin G | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
C4B-1846H | Native Human C4B Protein | +Inquiry |
Lectin-1811N | Active Native Narcissus Pseudonarcissus Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSGIN2-3525HCL | Recombinant Human OSGIN2 293 Cell Lysate | +Inquiry |
DDX56-7001HCL | Recombinant Human DDX56 293 Cell Lysate | +Inquiry |
PIGR-2868HCL | Recombinant Human PIGR cell lysate | +Inquiry |
CDK2-708HCL | Recombinant Human CDK2 cell lysate | +Inquiry |
KLRB1-4896HCL | Recombinant Human KLRB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PIS1 Products
Required fields are marked with *
My Review for All PIS1 Products
Required fields are marked with *
0
Inquiry Basket