Recombinant Full Length Saccharomyces Cerevisiae Calcium-Binding Mitochondrial Carrier Sal1(Sal1) Protein, His-Tagged
Cat.No. : | RFL36781SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Calcium-binding mitochondrial carrier SAL1(SAL1) Protein (P0CI40) (1-545aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-545) |
Form : | Lyophilized powder |
AA Sequence : | MLLKNCETDKQRDIRYACLFKELDVKGNGQVTLDNLISAFEKNDHPLKGNDEAIKMLFTA MDVNKDSVVDLSDFKKYASNAESQIWNGFQRIDLDHDGKIGINEINRYLSDLDNQSICNN ELNHELSNEKMNKFSRFFEWAFPKRKANIALRGQASHKKNTDNDRSKKTTDSDLYVTYDQ WRDFLLLVPRKQGSRLHTAYSYFYLFNEDVDLSSEGDVTLINDFIRGFGFFIAGGISGVI SRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVKSLYRQGG IKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMA AQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRGVTVGIVGIFPY AALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTVGASVVYPINLLRT RLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPAVSISYLCYENLKK FMNLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAL1 |
Synonyms | SAL1; Calcium-binding mitochondrial carrier SAL1; Suppressor of AAC2 lethality |
UniProt ID | P0CI40 |
◆ Recombinant Proteins | ||
fbp11-5649P | Recombinant Petunia fbp11 Protein (Met1-Glu228), N-GST tagged | +Inquiry |
BRAF-2782H | Recombinant Human BRAF Protein, His-tagged, BSA Conjugated | +Inquiry |
ABCA7-1083M | Recombinant Mouse ABCA7 Protein | +Inquiry |
SAOUHSC-00300-0105S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_00300 protein, His-tagged | +Inquiry |
TEKT2-756C | Recombinant Cynomolgus Monkey TEKT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
FLNA-170C | Active Native chicken FLNA | +Inquiry |
Lectin-1830R | Active Native Ricinus Communis Agglutinin I Protein, Agarose bound | +Inquiry |
C3-8391H | Native Human C3 | +Inquiry |
Ribulose-122S | Native Ribulose-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP2-533HCL | Recombinant Human RBP2 lysate | +Inquiry |
ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
ANKRD23-8854HCL | Recombinant Human ANKRD23 293 Cell Lysate | +Inquiry |
EIF3A-6664HCL | Recombinant Human EIF3A 293 Cell Lysate | +Inquiry |
Diencephalons-106R | Rhesus monkey Diencephalons Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAL1 Products
Required fields are marked with *
My Review for All SAL1 Products
Required fields are marked with *
0
Inquiry Basket