Recombinant Full Length Saccharomyces Cerevisiae C-5 Sterol Desaturase(Erg3) Protein, His-Tagged
Cat.No. : | RFL20072SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae C-5 sterol desaturase(ERG3) Protein (P32353) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MDLVLEVADHYVLDDLYAKVLPASLAANIPVKWQKLLGLNSGFSNSTILQETLNSKNAVK ECRRFYGQVPFLFDMSTTSFASLLPRSSILREFLSLWVIVTIFGLLLYLFTASLSYVFVF DKSIFNHPRYLKNQMAMEIKLAVSAIPWMSMLTVPWFVMELNGHSKLYMKIDYENHGVRK LIIEYFTFIFFTDCGVYLAHRWLHWPRVYRALHKPHHKWLVCTPFASHSFHPVDGFLQSI SYHIYPLILPLHKVSYLILFTFVNFWTVMIHDGQYLSNNPAVNGTACHTVHHLYFNYNYG QFTTLWDRLGGSYRRPDDSLFDPKLRDAKETWDAQVKEVEHFIKEVEGDDNDRIYENDPN TKKNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG3 |
Synonyms | ERG3; PSO6; SYR1; YLR056W; L2150; Delta(7-sterol 5(6-desaturase; C-5 sterol desaturase; Ergosterol Delta(5,6 desaturase; Sterol-C5-desaturase |
UniProt ID | P32353 |
◆ Recombinant Proteins | ||
RAB18A-11779Z | Recombinant Zebrafish RAB18A | +Inquiry |
YTFI-3401B | Recombinant Bacillus subtilis YTFI protein, His-tagged | +Inquiry |
SYK-35H | Recombinant Human SYK Protein, MYC/DDK-tagged | +Inquiry |
MRPL36-5579H | Recombinant Human MRPL36 Protein, GST-tagged | +Inquiry |
TFRC-0785R | Active Recombinant Rat TFRC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Immunoglobulin A-76H | Native Human Immunoglobulin A | +Inquiry |
Lectin-1722C | Native Canavalia ensiformis Lectin, Biotin conjugated | +Inquiry |
MMP9-38H | Native Human MMP-9 | +Inquiry |
PLF4-88H | Active Native Human PF 4 | +Inquiry |
CKM-26522TH | Native Human CKM | +Inquiry |
◆ Cell & Tissue Lysates | ||
RCAN1-510HCL | Recombinant Human RCAN1 cell lysate | +Inquiry |
DNAJC18-496HCL | Recombinant Human DNAJC18 cell lysate | +Inquiry |
SMOX-1655HCL | Recombinant Human SMOX 293 Cell Lysate | +Inquiry |
ARFGAP1-8754HCL | Recombinant Human ARFGAP1 293 Cell Lysate | +Inquiry |
PIGP-3195HCL | Recombinant Human PIGP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ERG3 Products
Required fields are marked with *
My Review for All ERG3 Products
Required fields are marked with *
0
Inquiry Basket