Recombinant Full Length Saccharomyces Cerevisiae Bud Site Selection Protein 9(Bud9) Protein, His-Tagged
Cat.No. : | RFL18172SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Bud site selection protein 9(BUD9) Protein (P53226) (1-547aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-547) |
Form : | Lyophilized powder |
AA Sequence : | MTKITRDVSITTENSKSTSGSATASSASLPENDHPIFHQPRARIRSGSLFIEGSDSFPSS EVKSYNVYIDDSKYSEILKGDTNSSSTDGKQVFEDARDDNFHQESHRDLEDSILDLVRRD PEVAAFPLPPPNSNERNRNSSNGSSAETNLNGHSSSGTISTSVLLNMGSAEKHAGTTRGD HMESSSMKSFEKLGTRPSSLFYPPPEGTAPYQGPRATVSGNKSTRQTQGTYSFPSMRYGV DLVSPVEGAVDVAKSRVPNSTLNGTFPDKAFIPHEFQIPKKAWNRIPANKSTSLKTPRNH SLLIDILKPFEAADLANDQRSSSAVLKNTVHSNGQYNPTNETSGTRMQDQRQKNTNEIDL EKIPNPQVPLGIAMDTMRSPNQLHEKEYESNIEAGLASGVGKGDNSIKQHQYKKIPQEID RDQQLSFQMETMPIQRIDSSSIRSFDSRIYGFSEIYSIPRVITTLCICLFVPPLFFFFSI NGNNGVSNYRLMRMIMNYEHRIGLLKGFEWDIDVQWFRTLCFVLGCIEMLAIFASIGIGF GVGIIRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BUD9 |
Synonyms | BUD9; YGR041W; G4152; Bud site selection protein 9 |
UniProt ID | P53226 |
◆ Native Proteins | ||
Fibrin-001H | Native Human Fibrin Protein | +Inquiry |
Stomach-004H | Human Stomach Lysate, Total Protein | +Inquiry |
Proteoglycans-51C | Native Chicken Proteoglycans | +Inquiry |
IgA-7430M | Active Native Mouse IgA Kappa Protein | +Inquiry |
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R1B-2940HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
IFNW1-1382HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
HYOU1-2295HCL | Recombinant Human HYOU1 cell lysate | +Inquiry |
STARD4-1707HCL | Recombinant Human STARD4 cell lysate | +Inquiry |
RAD51B-2554HCL | Recombinant Human RAD51L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BUD9 Products
Required fields are marked with *
My Review for All BUD9 Products
Required fields are marked with *
0
Inquiry Basket