Recombinant Full Length Human SMR3B Protein, C-Flag-tagged

Cat.No. : SMR3B-2158HFL
Product Overview : Recombinant Full Length Human SMR3B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Predicted to enable endopeptidase inhibitor activity. Predicted to be involved in cellular response to lipopolysaccharide; negative regulation of peptidase activity; and regulation of sensory perception of pain. Located in extracellular exosome.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 8 kDa
AA Sequence : MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPG IFPPPPPQP myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name SMR3B submaxillary gland androgen regulated protein 3B [ Homo sapiens (human) ]
Official Symbol SMR3B
Synonyms P-B; PBII; PRL3; PROL3; SMR1B
Gene ID 10879
mRNA Refseq NM_006685.4
Protein Refseq NP_006676.1
MIM 611593
UniProt ID P02814

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SMR3B Products

Required fields are marked with *

My Review for All SMR3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon