Recombinant Full Length Human SMR3B Protein, C-Flag-tagged

• Cat.No.: SMR3B-2158HFL
• Product Overview: Recombinant Full Length Human SMR3B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: Predicted to enable endopeptidase inhibitor activity. Predicted to be involved in cellular response to lipopolysaccharide; negative regulation of peptidase activity; and regulation of sensory perception of pain. Located in extracellular exosome.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 8 kDa
• AA Sequence: MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPG IFPPPPPQP myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: SMR3B submaxillary gland androgen regulated protein 3B [ Homo sapiens (human) ]
• Official Symbol: SMR3B
• Synonyms: P-B; PBII; PRL3; PROL3; SMR1B
• Gene ID: 10879
• mRNA Refseq: NM_006685.4
• Protein Refseq: NP_006676.1
• MIM: 611593
• UniProt ID: P02814