Recombinant Full Length Human SMR3B Protein, C-Flag-tagged
Cat.No. : | SMR3B-2158HFL |
Product Overview : | Recombinant Full Length Human SMR3B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Predicted to enable endopeptidase inhibitor activity. Predicted to be involved in cellular response to lipopolysaccharide; negative regulation of peptidase activity; and regulation of sensory perception of pain. Located in extracellular exosome. |
Source : | Mammalian cells |
Species : | Human |
Tag : | Flag |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 8 kDa |
AA Sequence : | MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPG IFPPPPPQP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SMR3B submaxillary gland androgen regulated protein 3B [ Homo sapiens (human) ] |
Official Symbol | SMR3B |
Synonyms | P-B; PBII; PRL3; PROL3; SMR1B |
Gene ID | 10879 |
mRNA Refseq | NM_006685.4 |
Protein Refseq | NP_006676.1 |
MIM | 611593 |
UniProt ID | P02814 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SMR3B Products
Required fields are marked with *
My Review for All SMR3B Products
Required fields are marked with *
0
Inquiry Basket