Recombinant Full Length Saccharomyces Cerevisiae Autophagy-Related Protein 32(Atg32) Protein, His-Tagged
Cat.No. : | RFL24993SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Autophagy-related protein 32(ATG32) Protein (B5VKG3) (1-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-529) |
Form : | Lyophilized powder |
AA Sequence : | MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE EEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGD EDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVL KSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYC RNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV KSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATG32 |
Synonyms | ATG32; ECM17; AWRI1631_90220; Autophagy-related protein 32; Extracellular mutant protein 37 |
UniProt ID | B5VKG3 |
◆ Recombinant Proteins | ||
Il4-315M | Recombinant Mouse Il4, His-tagged | +Inquiry |
NIF3L1-3195Z | Recombinant Zebrafish NIF3L1 | +Inquiry |
TBX19-9059M | Recombinant Mouse TBX19 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPANXN3-4292H | Recombinant Human SPANXN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL17146TF | Recombinant Full Length Treponema Pallidum Upf0092 Membrane Protein Tp_0409.1 (Tp_0409.1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Progesterone-01H | Native Human Progesterone | +Inquiry |
IGHD -20H | Native Human IgD | +Inquiry |
Collagen Type I & III-05C | Native Canine Collagen Type I and III Protein | +Inquiry |
Immunoglobulin A-76H | Native Human Immunoglobulin A | +Inquiry |
TNNI3-221H | Native Human TNNI3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMPA1-5214HCL | Recombinant Human IMPA1 293 Cell Lysate | +Inquiry |
HM13-5487HCL | Recombinant Human HM13 293 Cell Lysate | +Inquiry |
MCM4-4418HCL | Recombinant Human MCM4 293 Cell Lysate | +Inquiry |
GALNT2-907HCL | Recombinant Human GALNT2 cell lysate | +Inquiry |
NRF1-3699HCL | Recombinant Human NRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATG32 Products
Required fields are marked with *
My Review for All ATG32 Products
Required fields are marked with *
0
Inquiry Basket