Recombinant Full Length Saccharomyces Cerevisiae Acyl-Coa Desaturase 1(Ole1) Protein, His-Tagged
Cat.No. : | RFL34588SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Acyl-CoA desaturase 1(OLE1) Protein (P21147) (1-510aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-510) |
Form : | Lyophilized powder |
AA Sequence : | MPTSGTTIELIDDQFPKDDSASSGIVDEVDLTEANILATGLNKKAPRIVNGFGSLMGSKE MVSVEFDKKGNEKKSNLDRLLEKDNQEKEEAKTKIHISEQPWTLNNWHQHLNWLNMVLVC GMPMIGWYFALSGKVPLHLNVFLFSVFYYAVGGVSITAGYHRLWSHRSYSAHWPLRLFYA IFGCASVEGSAKWWGHSHRIHHRYTDTLRDPYDARRGLWYSHMGWMLLKPNPKYKARADI TDMTDDWTIRFQHRHYILLMLLTAFVIPTLICGYFFNDYMGGLIYAGFIRVFVIQQATFC INSLAHYIGTQPFDDRRTPRDNWITAIVTFGEGYHNFHHEFPTDYRNAIKWYQYDPTKVI IYLTSLVGLAYDLKKFSQNAIEEALIQQEQKKINKKKAKINWGPVLTDLPMWDKQTFLAK SKENKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSGGVYRHSNAAQNVLAD MRVAVIKESKNSAIRMASKRGEIYETGKFF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OLE1 |
Synonyms | OLE1; YGL055W; Acyl-CoA desaturase 1; Delta 9 fatty acid desaturase; Fatty acid desaturase 1; Stearoyl-CoA desaturase 1 |
UniProt ID | P21147 |
◆ Recombinant Proteins | ||
TBXA2R-9065M | Recombinant Mouse TBXA2R Protein, His (Fc)-Avi-tagged | +Inquiry |
HIST1H2BH-2096R | Recombinant Rhesus monkey HIST1H2BH Protein, His-tagged | +Inquiry |
RFL2746RF | Recombinant Full Length Rickettsia Felis Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
BTBD1-6785H | Recombinant Human BTBD1 protein, GST-tagged | +Inquiry |
DESI1A-10965Z | Recombinant Zebrafish DESI1A | +Inquiry |
◆ Native Proteins | ||
IGF2-29116TH | Native Human IGF2 | +Inquiry |
Laminin-33H | Native Human Laminin protein | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
Lectin-1866W | Active Native Succinylated Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C21orf33-8103HCL | Recombinant Human C21orf33 293 Cell Lysate | +Inquiry |
PLSCR1-3096HCL | Recombinant Human PLSCR1 293 Cell Lysate | +Inquiry |
RGS19-2379HCL | Recombinant Human RGS19 293 Cell Lysate | +Inquiry |
GABPB2-1095HCL | Recombinant Human GABPB2 cell lysate | +Inquiry |
Heart-464C | Cat Heart Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OLE1 Products
Required fields are marked with *
My Review for All OLE1 Products
Required fields are marked with *
0
Inquiry Basket