Recombinant Full Length Rinderpest Virus Hemagglutinin Glycoprotein(H) Protein, His-Tagged
Cat.No. : | RFL5991RF |
Product Overview : | Recombinant Full Length Rinderpest virus Hemagglutinin glycoprotein(H) Protein (P41355) (1-609aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | RDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-609) |
Form : | Lyophilized powder |
AA Sequence : | MSPPRDRVDAYYKDNFQFKNTRVVLNKEQLLIERPCMLLTVLFVMFLSLVGLLAIAGIRL HRAAVNTAKINNDLTTSIDITKSIEYQVKDVLTPLFKIIGDEVGLRTPQRFTDLTKFISD KIKFLNPDKEYDFRDINWCINPPERIKIDYDQYCAHTAAEDLITMLVNSSLTGTTVPRTS LVNLGRNCTGPTTTKGQFSNISLTLSGIYSGRGYNISSMITITGKGMYGSTYLVGKYNQR ARRPSKVWHQDYRVFEVGIIRELGVGTPGFHMTNYLELPRQPELETCMLALGESKLAALC LADSPVALHYGRVGDDNKIRFVKLGVWASPADRDTLATLSAIDPTLDGLYITTHRGIIAA GTAIWAVPVTRTDDQVKMGKCRLEACRDRPPPFCNSTDWEPLEAGRIPAYGVLTIKLGLA DEPKVDIISEFGPLITHDSGMDLYTSFDGTKYWLTTPPLQNSALGTVNTLVLEPSLKISP NILTLPIRSGGGDCYIPTYLSDRADDDVKLSSNLVILPSRDLQYVSATYDISRVEHAIVY HIYSTGRLSSYYYPFKLPIKGDPVSLQIECFPWDRKLWCHHFCSVVDSGTGEQVTHIGVV GIKITCNGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | H |
Synonyms | H; Hemagglutinin glycoprotein |
UniProt ID | P41355 |
◆ Recombinant Proteins | ||
EGFR-1227R | Recombinant Rhesus EGFR Protein, His-tagged | +Inquiry |
ACVR1B-332H | Recombinant Human Activin ACVR1B protein, Fc-tagged | +Inquiry |
UBE2G1-17716M | Recombinant Mouse UBE2G1 Protein | +Inquiry |
ABHD6-1135M | Recombinant Mouse ABHD6 Protein | +Inquiry |
SCO5553-1073S | Recombinant Streptomyces coelicolor A3(2) SCO5553 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
F9-26523H | Active Native Human F9 Protein | +Inquiry |
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDX5-2878HCL | Recombinant Human PRDX5 293 Cell Lysate | +Inquiry |
PCDHB13-3393HCL | Recombinant Human PCDHB13 293 Cell Lysate | +Inquiry |
ZFP1-1973HCL | Recombinant Human ZFP1 cell lysate | +Inquiry |
GIMAP5-5937HCL | Recombinant Human GIMAP5 293 Cell Lysate | +Inquiry |
KHDRBS2-4987HCL | Recombinant Human KHDRBS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All H Products
Required fields are marked with *
My Review for All H Products
Required fields are marked with *
0
Inquiry Basket