Recombinant Full Length Rickettsia Typhi Putative Export Atp-Binding/Permease Protein Rt0691(Rt0691) Protein, His-Tagged
Cat.No. : | RFL31833RF |
Product Overview : | Recombinant Full Length Rickettsia typhi Putative export ATP-binding/permease protein RT0691(RT0691) Protein (Q68W42) (1-576aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-576) |
Form : | Lyophilized powder |
AA Sequence : | MDIKLLYRLAKYLRFYKKDLIIVMISLLSVSASLLLIGSVFRNLIDKGLAEDNILSVNKS ILYICLLIVILSVASFFRSYFINNVAEKIVNQIRKEAYSNLINYEIEEYEELKIGDIISR LTNDIDQIATLIVNFLSFFIRNSVMLIGGITLMFFESFKLASIVIVTIPILLVPLIKFGK HVKSLSKKALESKSLLVSDIDETFNNIRVIYAFNHQINKISDFDTKLQSYLIYCKIRLKI RALFFAISIAVIFLTITLIVWIGASDIVQGDLSAGQIISFIYYAIIAGVSSGGIFELLSE IHLPTTALERIITIIDKISIVHNNYYALNNPDTVSIEFKNVDFTYNSRPNLKIINNMSLK INANKFVGIVGRSGAGKSTLIQLLLRFYRQDNGTILINNQDISRINPTDIRKFIAYVPQE ASIFSDTIKSNIIFGNNKASDYEINEIIKITGIEEFSNKLHDGINTKIGEKGVRLSGGQK QRIAIARALLRKPKILLLDEAMSALDTMSEQKLLNAIKKIMKGNIIISIAHRISSIESAD YILVIDKGKVVTAGSHYDLSKNSEIYRNICREQLTI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RT0691 |
Synonyms | RT0691; Putative export ATP-binding/permease protein RT0691 |
UniProt ID | Q68W42 |
◆ Native Proteins | ||
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
COX1-31S | Active Native Sheep COX1 protein | +Inquiry |
CTLGV2EB-359C | Active Native Chlamydia trachomatis LGV Type-2 EB Protein | +Inquiry |
MB-236B | Native Bovine Myoglobin | +Inquiry |
Lectin-1738S | Active Native Sambucus Nigra Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNJ4-5046HCL | Recombinant Human KCNJ4 293 Cell Lysate | +Inquiry |
LAPTM4A-4823HCL | Recombinant Human LAPTM4A 293 Cell Lysate | +Inquiry |
TGM4-1110HCL | Recombinant Human TGM4 293 Cell Lysate | +Inquiry |
CDCA7L-7639HCL | Recombinant Human CDCA7L 293 Cell Lysate | +Inquiry |
NECAP1-3887HCL | Recombinant Human NECAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RT0691 Products
Required fields are marked with *
My Review for All RT0691 Products
Required fields are marked with *
0
Inquiry Basket