Recombinant Full Length Rickettsia Typhi Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged
Cat.No. : | RFL31058RF |
Product Overview : | Recombinant Full Length Rickettsia typhi Lipoprotein signal peptidase(lspA) Protein (Q68WX1) (1-196aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-196) |
Form : | Lyophilized powder |
AA Sequence : | MISLFKKLYFTFSRSSRIIITLVIIDQLTKWWFINNLRWKPGLMLKVTSILNMVYTWNYG ISFGLMREYYQYSNAIFLITNMIIVCYLYHLMICSKTIGSFVGYNFVIGGAIGNLIDRFC RGAVFDFIHFHYRNYSFPVFNLADCFITLGVIILIEDYFSTKKVIEETSKENFDNLQIEA MAAKIRNTDHVSNDKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lspA |
Synonyms | lspA; RT0394; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II |
UniProt ID | Q68WX1 |
◆ Recombinant Proteins | ||
RFL5951DF | Recombinant Full Length Debaryomyces Hansenii Glycosylphosphatidylinositol Anchor Biosynthesis Protein 11(Gpi11) Protein, His-Tagged | +Inquiry |
APH1B-1768M | Recombinant Mouse APH1B Protein | +Inquiry |
CRYBA4-4987H | Recombinant Human Crystallin, Beta A4, His-tagged | +Inquiry |
AXIN2-3796H | Recombinant Human AXIN2, His-tagged | +Inquiry |
TRIM13-5927R | Recombinant Rat TRIM13 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Fga-63R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
Lectin-1864W | Active Native Succinylated Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
CTRC-27191TH | Native Human CTRC | +Inquiry |
GGT1-5353H | Native Human Gamma-Glutamyltransferase 1 | +Inquiry |
IgG-017R | Native Rabbit IgG Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Kidney-145H | Human Fetal Kidney Lysate | +Inquiry |
PPYR1-1409HCL | Recombinant Human PPYR1 cell lysate | +Inquiry |
TTI2-7951HCL | Recombinant Human C8orf41 293 Cell Lysate | +Inquiry |
TAZ-1233HCL | Recombinant Human TAZ 293 Cell Lysate | +Inquiry |
ENDOG-6602HCL | Recombinant Human ENDOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lspA Products
Required fields are marked with *
My Review for All lspA Products
Required fields are marked with *
0
Inquiry Basket