Recombinant Full Length Bacillus Halodurans Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged
Cat.No. : | RFL34901BF |
Product Overview : | Recombinant Full Length Bacillus halodurans Lipoprotein signal peptidase(lspA) Protein (Q9K9V2) (1-156aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Halodurans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-156) |
Form : | Lyophilized powder |
AA Sequence : | MIYYIVALVIILLDQWTKWLVVRHMEIGESIPLLDSVLYLTSHRNKGAAFGILEGQMWLF YIITSIVVIGIVYYMEKEAKHDRVFATALALILGGAIGNFIDRIFRGEVVDFVNTYIFTY NFPIFNVADSALCVGVGILFLKMIRDERKAKKEKNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lspA |
Synonyms | lspA; lsp; BH2543; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II |
UniProt ID | Q9K9V2 |
◆ Recombinant Proteins | ||
N-261S | Recombinant Human Coronavirus N protein, His-tagged | +Inquiry |
RPS6KA6-4242HF | Active Recombinant Full Length Human RPS6KA6 Protein, GST-tagged | +Inquiry |
MB-2678C | Recombinant Chicken MB protein, His & T7-tagged | +Inquiry |
PTGES2-5623H | Recombinant Human PTGES2 protein, His & T7-tagged | +Inquiry |
xr-1380N | Recombinant Neurospora crassa xr Protein (M1-G322) | +Inquiry |
◆ Native Proteins | ||
FTH1-001H | Native Horse FTH1 Protein | +Inquiry |
PIV3-20 | Native Parainfluenza Virus Type 3 Antigen | +Inquiry |
GHRH-37H | Active Native Human GHRH | +Inquiry |
HB-44R | Native Rabbit Hemoglobin (HB) Protein | +Inquiry |
MB-02B | Native Bovine MB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MET-1931CCL | Recombinant Canine MET cell lysate | +Inquiry |
FSTL3-2793MCL | Recombinant Mouse FSTL3 cell lysate | +Inquiry |
ACYP2-9041HCL | Recombinant Human ACYP2 293 Cell Lysate | +Inquiry |
DZIP3-6744HCL | Recombinant Human DZIP3 293 Cell Lysate | +Inquiry |
CKS1B-361HCL | Recombinant Human CKS1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lspA Products
Required fields are marked with *
My Review for All lspA Products
Required fields are marked with *
0
Inquiry Basket