Recombinant Full Length Rickettsia Rickettsii Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL21662RF |
Product Overview : | Recombinant Full Length Rickettsia rickettsii Membrane protein insertase YidC(yidC) Protein (B0BVZ4) (1-560aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia rickettsii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-560) |
Form : | Lyophilized powder |
AA Sequence : | MNNNIINLIAAIILSLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKKQQLKALVEPATG IVVQEESQVQRIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSSEVRLFSPANTENA YFAEVGLVSNLSSVKLPNNDTIWNSDSEILSPEKPVHLFWVNEDGVKFLVTITVDENYLF TIEQTIVNNSDKELPVQSYGLINRKYIAVEKAVNILHQGPIGCIDENLKEYSYDDIKDKK SEKFAASKVDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQGIERYQVDFISPVQIIKPG KNFSIKSRIFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGN FGVSILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKARLNQEIMALYK KEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTTIFNLFGLL PFAPPSFLMIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLI YWSWNNILSIIQQYYINKFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; RrIowa_0098; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B0BVZ4 |
◆ Recombinant Proteins | ||
ARGC-930S | Recombinant Streptomyces coelicolor A3(2) ARGC protein, His-tagged | +Inquiry |
PYGB-2857H | Recombinant Human PYGB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Lysenin-78E | Recombinant Eisenia fetida Lysenin protein, His-tagged | +Inquiry |
CDKN1B-2704H | Recombinant Human CDKN1B protein, His-tagged | +Inquiry |
TFPI-42FLH | Recombinant Human TFPI Protein, Full Length, C-His tagged | +Inquiry |
◆ Native Proteins | ||
FGG -60R | Native Rabbit Fibrinogen | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
C1q-07R | Native Rat C1q Protein | +Inquiry |
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSEN2-1843HCL | Recombinant Human TSEN2 cell lysate | +Inquiry |
DHX40-6928HCL | Recombinant Human DHX40 293 Cell Lysate | +Inquiry |
FHL2-6223HCL | Recombinant Human FHL2 293 Cell Lysate | +Inquiry |
ACSL3-9077HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
WDR31-352HCL | Recombinant Human WDR31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket