Recombinant Full Length Haemophilus Influenzae Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL19340HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Membrane protein insertase YidC(yidC) Protein (A5UD72) (1-541aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-541) |
Form : | Lyophilized powder |
AA Sequence : | MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELLKDTKEHIYIAQSGLI GKNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGSYDLGVDY KIDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSETNYKKYSFADMQDNNLS IDTKAGWVAVLQHYFVSAWIPNQDVNNQLYTITDSKNNVASIGYRGPVVTIPAGSQETIT SSLWTGPKLQNQMATVANNLDLTVDYGWAWFIAKPLFWLLTFIQGIVSNWGLAIICVTIV VKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDDRQRMSQEMMKLYKEEKVNPLGGCL PILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYYILPILMGISMFLLQKMSPT PVTDPTQQKVMNFMPLIFMVFFLWFPSGLVLYWLVSNLITIAQQQLIYRGLEKKGLHSRK K |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; CGSHiEE_06970; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | A5UD72 |
◆ Recombinant Proteins | ||
Sele-164M | Recombinant Mouse Sele Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL15764AF | Recombinant Full Length Anaeromyxobacter Sp. Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
GPR77-5263H | Recombinant Human GPR77 Protein | +Inquiry |
NI36-RS08690-0954S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS08690 protein, His-tagged | +Inquiry |
PDE6C-6589M | Recombinant Mouse PDE6C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1783G | Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 594 Labeled | +Inquiry |
Mannose Binding Lectin-044H | Native Human Mannose Binding Lectin Protein | +Inquiry |
LYZ-139C | Native Chicken lysozyme | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
Trf-4782M | Native Mouse Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRR1-1398HCL | Recombinant Human LRR1 cell lysate | +Inquiry |
Adipose-5M | Mouse Adipose Membrane Lysate | +Inquiry |
METTL11A-4360HCL | Recombinant Human METTL11A 293 Cell Lysate | +Inquiry |
COX8A-194HCL | Recombinant Human COX8A lysate | +Inquiry |
DYNC1H1-519HCL | Recombinant Human DYNC1H1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket