Recombinant Full Length Rickettsia Felis Putative Sensor Histidine Kinase Ntry-Like(Rf_0427) Protein, His-Tagged
Cat.No. : | RFL12076RF |
Product Overview : | Recombinant Full Length Rickettsia felis Putative sensor histidine kinase ntrY-like(RF_0427) Protein (Q4UMD4) (1-599aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia felis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-599) |
Form : | Lyophilized powder |
AA Sequence : | MLSYLKKNLRSYFSSRVLIFTLAIAAIIFACATFYVISLESKNFSTIIGFLLVDLAIFLI LGVLLTQKFFTQNSNNDSSKLQNRIVIAFSLVAAIPTIIVSVFSVYFFNLSVQAWFDKKI STVLDQSVIVAESYIAEHKLQLKETALAVAEDLSDMYYDLIHNPALFTKTLNTEAEMRSL DEAIVLNKSTNTIVANSYLSFSLSFATIPAHLIKKADLGEPVEVKSDPTKIRMLIKLKEY NDVYLLVGRLVDNKIIDHIDATNGAAAEYNSLKNEIDNIQIKFSIMFIFIALLLLFVAIS FGVIFTAKIVKPIKKLVTATDKVKDGDLTVQVPENEVDKDEIGTLYAAFNRMIKQLSRQQ RDLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLKKFSPEIKEKEEFENYLKMIIR HTNDIKNIVSEFVLFARLPAPKFTKSELVYLVKHIVEARKLLNDNILYKFESNVDQFDFM CDATQINQVMINLLKNAEESIEGRESGKIEVTIDAKDDFISVIVIDSGKGFPPELIGKAT ESYVTTSSKGMGVGLAIVKRIVEEHCGILDIANREEEGAIIDIKFDLKKLDLKVGRSGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RF_0427 |
Synonyms | RF_0427; Putative sensor histidine kinase NtrY-like |
UniProt ID | Q4UMD4 |
◆ Recombinant Proteins | ||
HOXA2-6707C | Recombinant Chicken HOXA2 | +Inquiry |
KRT7-8846M | Recombinant Mouse KRT7 Protein | +Inquiry |
NTS-1409C | Recombinant Cynomolgus NTS protein, His-tagged | +Inquiry |
NUDT1-2809H | Recombinant Human NUDT1 Protein (19-197 aa), His-tagged | +Inquiry |
RFL13057CF | Recombinant Full Length Cuscuta Gronovii Photosystem I Assembly Protein Ycf4(Ycf4) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
MMP9-38H | Native Human MMP-9 | +Inquiry |
LDL-247H | Native Human Lipoproteins, Very Low Density | +Inquiry |
LDH-35C | Active Native Chicken Lactate dehydrogenase | +Inquiry |
EDN3-8304H | Native Human EDN3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MATN4-4448HCL | Recombinant Human MATN4 293 Cell Lysate | +Inquiry |
UBE2A-594HCL | Recombinant Human UBE2A 293 Cell Lysate | +Inquiry |
FCGR3A-1999HCL | Recombinant Human FCGR3A cell lysate | +Inquiry |
UCHL1-535HCL | Recombinant Human UCHL1 293 Cell Lysate | +Inquiry |
U-937-063HCL | Human U-937 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RF_0427 Products
Required fields are marked with *
My Review for All RF_0427 Products
Required fields are marked with *
0
Inquiry Basket