Recombinant Full Length Rickettsia Conorii Surf1-Like Protein(Rc1113) Protein, His-Tagged
Cat.No. : | RFL27635RF |
Product Overview : | Recombinant Full Length Rickettsia conorii SURF1-like protein(RC1113) Protein (Q92GL0) (1-240aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia conorii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-240) |
Form : | Lyophilized powder |
AA Sequence : | MKTNFLVFITFTILISLGFWQLSRLKEKKLFLASMQANLTSPAINLAEIQDGLPYHKVKI TGQFLPNKDIYLYGRRSMSSEKDGYYLVTPFKTIEDKVILVARGWFSNRNKNIITQATND RQHEIIGVTMPSEKTRIYLPANDIKNNVWLTLNLKETSKVLGLDLENFYIIAEGKDISNL DILLPLAINHLAAIRNDHLEYALTWFGLAISLIVIYVIYRRRYMAVDVIPRACSGIQKNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RC1113 |
Synonyms | RC1113; SURF1-like protein |
UniProt ID | Q92GL0 |
◆ Recombinant Proteins | ||
flaA-1338L | Recombinant Listeria monocytogenes flaA protein(Met1-Ser287), His-tagged | +Inquiry |
Afp-5337M | Recombinant Mouse Afp protein, His-tagged | +Inquiry |
GPKOW-301622H | Recombinant Human GPKOW protein, GST-tagged | +Inquiry |
CA5B-0154H | Recombinant Human CA5B Protein (Cys34-Pro317), N-His-tagged | +Inquiry |
KLRG1-0320M | Active Recombinant Mouse KLRG1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GG-191P | Native Porcine Gamma Globulin protein | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
TRIM21-212B | Native Cow TRIM21 | +Inquiry |
Hp1-1-195H | Native Human Haptoglobin 1-1 | +Inquiry |
Lectin-1734U | Active Native Ulex Europaeus Agglutinin I Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFYA-3840HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
TMEM80-930HCL | Recombinant Human TMEM80 293 Cell Lysate | +Inquiry |
Apple-680P | Apple Lysate, Total Protein | +Inquiry |
Uterus-748R | Rabbit Uterus Lysate, Total Protein | +Inquiry |
ACOT8-9086HCL | Recombinant Human ACOT8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RC1113 Products
Required fields are marked with *
My Review for All RC1113 Products
Required fields are marked with *
0
Inquiry Basket