Recombinant Full Length Rickettsia Conorii Putative Export Atp-Binding/Permease Protein Rc1073(Rc1073) Protein, His-Tagged
Cat.No. : | RFL29485RF |
Product Overview : | Recombinant Full Length Rickettsia conorii Putative export ATP-binding/permease protein RC1073(RC1073) Protein (Q92GP9) (1-576aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia conorii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-576) |
Form : | Lyophilized powder |
AA Sequence : | MDIKLLYRLAKYLRCYKKDLIIVMISLLSVSASLLLIGSVFRNLVDKGLSKDHISSVDNS ILYICLLIIILSIASFFRSYFINNVAEKAVNQIRKEAYSNLINYEIEEFEELKIGDIISR LTNDIDQISTLIVNFLSFFIRNSVMLIGSITLMFFESFKLASIVIITIPILLIPLIKFGK HVKVLSKKALESKSLLASDINETFNNIRAIYAFNHQINKIADFDTKLQNYLIYCKTRLKI RALFFAISIAVIFLAITLVVWIGASDIVKGHLSAGQIISFIYYAIIAGVSCGGIFELLSE MHLPVTALERIITIIDKTPIAHNNYLELNNSDPISIEFKNVDFTYHSRPNLRIINNMSLK INANKFLGIVGRSGAGKSTVIQLLLRFYRQENGTILINNQDITLLNPAEIRKLIAYVPQE ASIFSGTIKSNIIFGNNEASDDEINEIIKITGIEEFAAKLHDGINAKIGERGVRLSGGQK QRIAIARALLRMPQILLLDEAMSALDTMSEQKLLESIKKIMRGNIIISIAHRISSIESAD YILVIDKGGVVAEGSHNDLSKNSEIYRNICREQLTI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RC1073 |
Synonyms | RC1073; Putative export ATP-binding/permease protein RC1073 |
UniProt ID | Q92GP9 |
◆ Recombinant Proteins | ||
CLDN9-1736M | Recombinant Mouse CLDN9 Protein, His (Fc)-Avi-tagged | +Inquiry |
TGM4-6043R | Recombinant Rat TGM4 Protein | +Inquiry |
RT-89H | Active Recombinant HIV-1 RT | +Inquiry |
HSD3B7-2936R | Recombinant Rat HSD3B7 Protein | +Inquiry |
RFL36038AF | Recombinant Full Length Arabidopsis Thaliana Uncharacterized Mitochondrial Protein Atmg01350 (Atmg01350) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgA-252H | Native Human Immunoglobulin A | +Inquiry |
RPE-426 | Native RPE | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
Flavin-containing Amine oxidase-010B | Native Bovine Flavin-containing Amine oxidase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNXB-876HCL | Recombinant Human TNXB 293 Cell Lysate | +Inquiry |
COA5-8067HCL | Recombinant Human C2orf64 293 Cell Lysate | +Inquiry |
LRRC36-4633HCL | Recombinant Human LRRC36 293 Cell Lysate | +Inquiry |
FTL-6126HCL | Recombinant Human FTL 293 Cell Lysate | +Inquiry |
ILK-5219HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RC1073 Products
Required fields are marked with *
My Review for All RC1073 Products
Required fields are marked with *
0
Inquiry Basket