Recombinant Full Length Ricinus Communis Upf0392 Protein Rcom_0530710 (Rcom_0699480) Protein, His-Tagged
Cat.No. : | RFL31296RF |
Product Overview : | Recombinant Full Length Ricinus communis UPF0392 protein RCOM_0530710 (RCOM_0699480) Protein (B9S2H4) (1-578aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ricinus Communis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-578) |
Form : | Lyophilized powder |
AA Sequence : | MESEQRRKRKRIYKPDSTSNSFFSVRSLTACLSFFVFLLFISSDRSPIKTVSFRPVLNVP VSLLPTPLGLTRDSFDTKSLPLIVEDRVLLPDHVLLIVSNKVATSQNLDCVYSNLYNSHD VVLKPALSVNQYHRDKSIVRCQLPPNNYSAAVYLRWSWEAAEGVAAAAPASVVSWDRVVY EAMLDWNTVAVFVKGLNLRPHKESDSSKFRCHFGLSKFDKDEGIVFTTEAITAAQEVIRC LLPRSIRNNPVKAQGIRVTVSRINAGEDGVDAPLPSVAKVYGAKSYEKRSNRGKYELCAC TMLWNQASFLHEWITYHAWLGVQRWFIYDNNSDDGIQEVVDELNLQNYNVTRHSWPWIKA QEAGFSHCALRARSECKWLGFFDVDEFFYLPRHRGQDMLGENSLRTLVANYSDSSTYAEI RTICHSFGPSGLTSAPSQGVTVGYTCRLQAPERHKSIVRPELLDTTLLNVVHHFKLKEGY RYLNVPESTAVVNHYKYQVWDTFKAKFFRRVSTYVANWQEDQNQGSKDRAPGLGTVAIEP PDWRLRFCEVWDTGLKDFVLANFADTASGYLPWERSPF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RCOM_0699480 |
Synonyms | RCOM_0699480; Glycosyltransferase family 92 protein RCOM_0530710 |
UniProt ID | B9S2H4 |
◆ Recombinant Proteins | ||
EXT2-1446H | Recombinant Human EXT2 Protein, His-tagged | +Inquiry |
FAM19A4-3732H | Recombinant Human FAM19A4 Protein, GST-tagged | +Inquiry |
OR9K2-3059R | Recombinant Rhesus Macaque OR9K2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSG1-6025H | Recombinant Human PSG1 Protein (Gln35-Pro419), C-His tagged | +Inquiry |
ASRGL1-2046M | Recombinant Mouse ASRGL1 Protein | +Inquiry |
◆ Native Proteins | ||
IgY-006D | Native Duck IgY | +Inquiry |
SERPINF2-5338H | Active Native Human SERPINF2 Protein | +Inquiry |
Hb-001H | Native Human Hb Protein | +Inquiry |
IgG2-230H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
PLP-21 | Native Mouse/Rat PLP (139-151) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFC-1306RCL | Recombinant Rat VEGFC cell lysate | +Inquiry |
C21orf119-8105HCL | Recombinant Human C21orf119 293 Cell Lysate | +Inquiry |
TMLHE-918HCL | Recombinant Human TMLHE 293 Cell Lysate | +Inquiry |
RPS5-566HCL | Recombinant Human RPS5 lysate | +Inquiry |
ALS2-66HCL | Recombinant Human ALS2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RCOM_0699480 Products
Required fields are marked with *
My Review for All RCOM_0699480 Products
Required fields are marked with *
0
Inquiry Basket