Recombinant Full Length Rhomboid Protease Glpg(Glpg) Protein, His-Tagged
Cat.No. : | RFL36602EF |
Product Overview : | Recombinant Full Length Rhomboid protease glpG(glpG) Protein (Q8FCS5) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glpG |
Synonyms | glpG; c4201; Rhomboid protease GlpG; Intramembrane serine protease |
UniProt ID | Q8FCS5 |
◆ Recombinant Proteins | ||
TAOK3-3112H | Recombinant Human TAOK3 protein, His-tagged | +Inquiry |
cesA-1443B | Recombinant Bacillus subtilis cesA Protein (M1-R300), His-tagged | +Inquiry |
MCFD2-1836H | Recombinant Human MCFD2, T7-tagged | +Inquiry |
LZIC-5010H | Recombinant Human LZIC, His-tagged | +Inquiry |
CFC1-652R | Recombinant Rhesus Macaque CFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
SAP-96H | Native Human Serum amyloid P | +Inquiry |
FTH1-28155TH | Native Human FTH1 | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
Lectin-1866W | Active Native Succinylated Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP16-470HCL | Recombinant Human USP16 293 Cell Lysate | +Inquiry |
MCPH1-4412HCL | Recombinant Human MCPH1 293 Cell Lysate | +Inquiry |
RAB28-2612HCL | Recombinant Human RAB28 293 Cell Lysate | +Inquiry |
FMO2-6183HCL | Recombinant Human FMO2 293 Cell Lysate | +Inquiry |
HA-2333HCL | Recombinant H3N2 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All glpG Products
Required fields are marked with *
My Review for All glpG Products
Required fields are marked with *
0
Inquiry Basket