Recombinant Full Length Escherichia Coli O6:K15:H31 Rhomboid Protease Glpg(Glpg) Protein, His-Tagged
Cat.No. : | RFL11695EF |
Product Overview : | Recombinant Full Length Escherichia coli O6:K15:H31 Rhomboid protease glpG(glpG) Protein (Q0TC44) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glpG |
Synonyms | glpG; ECP_3509; Rhomboid protease GlpG; Intramembrane serine protease |
UniProt ID | Q0TC44 |
◆ Recombinant Proteins | ||
RGMA-2416H | Recombinant Human RGM Domain Family, Member A, FLAG-tagged | +Inquiry |
PRSS35-429Z | Recombinant Zebrafish PRSS35 | +Inquiry |
CSNK1G3-2197HF | Recombinant Full Length Human CSNK1G3 Protein, GST-tagged | +Inquiry |
MMP7-5435H | Recombinant Human MMP7 Protein, GST-tagged | +Inquiry |
RFL1019LF | Recombinant Full Length Loxodonta Africana Suppressor Of Tumorigenicity 7 Protein(St7) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
PLAU-8456H | Active Native Human PLAU | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
C3b-08H | Native Human Complement C3 beta protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPNE8-7307HCL | Recombinant Human CPNE8 293 Cell Lysate | +Inquiry |
MET-1931CCL | Recombinant Canine MET cell lysate | +Inquiry |
INSL5-5190HCL | Recombinant Human INSL5 293 Cell Lysate | +Inquiry |
Testis-513C | Cynomolgus monkey Testis Membrane Lysate | +Inquiry |
KCNE1L-5066HCL | Recombinant Human KCNE1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All glpG Products
Required fields are marked with *
My Review for All glpG Products
Required fields are marked with *
0
Inquiry Basket