Recombinant Full Length Rhodospirillum Centenum Upf0761 Membrane Protein Rc1_0578 (Rc1_0578) Protein, His-Tagged
Cat.No. : | RFL11RF |
Product Overview : | Recombinant Full Length Rhodospirillum centenum UPF0761 membrane protein RC1_0578 (RC1_0578) Protein (B6IRC8) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodospirillum centenum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MLTSDRLRGMLRRLPGRLPDAVGVVRHAVPRFWNNNGFAIAASLTYTTLLALVPLLTVTF AIFSAFPAYGRLRDTARELIFDSLAPSVSDEVQAYFDQFISNAAALTGFGVIGLSLTSIL LFFSVEAALNVIFRATEPRPLVIRLLSFWAVLTIMPLLLGASLSVTSGVVADLQATGRDA VTVLRFMLPGLLEAAAFTLMFLMIPNREVQWFDALVGGIAAALLMEVSKVGFGLYIAAFP TYETIYGALSVIPIFLFWLYTVWSVVLFGAEITATLPEWRAGKITQVGPEGLLSAQRIVV AVAILHELQRAARLGVGIRRGTLSTRVPVGANVIDGMLEQLQAAHWVARTRDGAWVATRN LSDATVDDLRHSLGMAIRGNLRSVGHLSAGWQNRLADLFERAEAADREVLGVCFADLFAD PPSGQPSGQVETAVRQRTGLQGRI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RC1_0578 |
Synonyms | RC1_0578; UPF0761 membrane protein RC1_0578 |
UniProt ID | B6IRC8 |
◆ Recombinant Proteins | ||
GSTT4-7344M | Recombinant Mouse GSTT4 Protein | +Inquiry |
CALCA-2643M | Recombinant Mouse CALCA Protein | +Inquiry |
MRPL18-2837R | Recombinant Rhesus monkey MRPL18 Protein, His-tagged | +Inquiry |
RFL30908AF | Recombinant Full Length Acidianus Two-Tailed Virus Putative Transmembrane Protein Orf175 Protein, His-Tagged | +Inquiry |
Fert2-310M | Recombinant Mouse Fert2, GST-tagged, Active | +Inquiry |
◆ Native Proteins | ||
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
CNAN-133A | Native Arachis hypogaea seed Conarachin | +Inquiry |
GC-198H | Native Human GC-Globulin | +Inquiry |
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
SERPINC1-26143TH | Native Human SERPINC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKNOX1-3148HCL | Recombinant Human PKNOX1 293 Cell Lysate | +Inquiry |
NPAS2-1208HCL | Recombinant Human NPAS2 cell lysate | +Inquiry |
NSFL1C-3687HCL | Recombinant Human NSFL1C 293 Cell Lysate | +Inquiry |
CCL20-447MCL | Recombinant Mouse CCL20 cell lysate | +Inquiry |
FCAR-3040HCL | Recombinant Human FCAR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RC1_0578 Products
Required fields are marked with *
My Review for All RC1_0578 Products
Required fields are marked with *
0
Inquiry Basket