Recombinant Full Length Rhodopseudomonas Palustris Beta-(1-->2)Glucan Export Atp-Binding/Permease Protein Ndva(Ndva) Protein, His-Tagged
Cat.No. : | RFL23756RF |
Product Overview : | Recombinant Full Length Rhodopseudomonas palustris Beta-(1-->2)glucan export ATP-binding/permease protein NdvA(ndvA) Protein (Q20Z38) (1-604aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodopseudomonas palustris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-604) |
Form : | Lyophilized powder |
AA Sequence : | MSMLRLYTRVLQLLGGEARLGWILAFANLLLAGAQFAEPVLFGRIVDVLSGNLSTGALQT SVASPWPLLGAWVAFGLFTILCSAAVALHADRLAHRQRQAILTSYFEHIMQLPLTYHTGT HSGRLMKVMLQGTDALWRLWLGFFREHFAAILSLVVLLPLALYINWRLAILLFILCVVFT VLTTLVVHKTYSMQGEVEEQYSDLSARASDALGNVALVQSFVRIDAEVQGLRFVADRLLA LQMPVLSWWALVTVITRASTTITVLAIFTVGIALHEQGLTSVGEIVMFVSFATLLIQKLE QVVSFINSVFMEAPRLQEFFNVLDAVPAVRDRPDAVDPERLQGLVEFKDVSFSYDGKRPA VADLSFTARPGETIALVGATGAGKSTAIALLHRAFDPQSGVIRIDGLDVRDLTLAGLRRN IGVVFQEALLFNRSIADNLRVGKPDATEEEMRTAASRAQALDFIERSEQKFDTNAGERGR MLSGGERQRLSIARALLKDPPILILDEATSALDAVTEAKVNLALDEVMKGRTTFVIAHRL STIRHATRILVFEAGRVIESGTFDELLARQGHFAALARAQFMVQETSRANMAAPLEHAAS AKIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndvA |
Synonyms | ndvA; RPC_4072; Beta-(1-->2glucan export ATP-binding/permease protein NdvA |
UniProt ID | Q20Z38 |
◆ Recombinant Proteins | ||
GEMIN8-5313HF | Recombinant Full Length Human GEMIN8 Protein, GST-tagged | +Inquiry |
KCNN4-16H | Recombinant Human KCNN4 Full Length Transmembrane protein, His-tagged | +Inquiry |
Smpd2-8254R | Recombinant Rat Smpd2 protein, His & GST-tagged | +Inquiry |
RFL18287SF | Recombinant Full Length Elastin-Binding Protein Ebps(Ebps) Protein, His-Tagged | +Inquiry |
UBE2I-6057R | Recombinant Rat UBE2I Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-242H | Native Human Lipoproteins, High Density | +Inquiry |
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
Staphylococcus aureus-01 | Native S. aureus Suspension (Wood 46 strain) | +Inquiry |
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLA2-1810HCL | Recombinant Human SLA2 293 Cell Lysate | +Inquiry |
CHN2-7528HCL | Recombinant Human CHN2 293 Cell Lysate | +Inquiry |
ZNF436-72HCL | Recombinant Human ZNF436 293 Cell Lysate | +Inquiry |
SDCCAG3-2013HCL | Recombinant Human SDCCAG3 293 Cell Lysate | +Inquiry |
SERF2-1947HCL | Recombinant Human SERF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndvA Products
Required fields are marked with *
My Review for All ndvA Products
Required fields are marked with *
0
Inquiry Basket