Recombinant Full Length Rhodoferax Ferrireducens Upf0761 Membrane Protein Rfer_2991(Rfer_2991) Protein, His-Tagged
Cat.No. : | RFL28263RF |
Product Overview : | Recombinant Full Length Rhodoferax ferrireducens UPF0761 membrane protein Rfer_2991(Rfer_2991) Protein (Q21U51) (1-416aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodoferax ferrireducens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-416) |
Form : | Lyophilized powder |
AA Sequence : | MHMPPHLPASPPLSWPQRLEALLKDLTNFPWKSTARTLRERYSEDRLGLTASSLTFTTTM ALVPLVTVALAIFTAFPMFAKLQSVLQKWLVTSLIPDNIARQVLGYLTQFAGQASKLGGA GIALLLVTAVALILTIDHTLNGIWRVRTRRSLGQRVLVYWAALTLGPLVLGVSLSITSYA ISASKGVVGVMPGGVQFLLDVLQFFMVAWGMAAMYHFVPNTWVKWSHAWAGGMFVSAGLE LAKKLLALYLGKVPTYSVLYGAFATVPILLIWIYVAWIIVLLGAVIAAYLPSLTSGIQHR GRSHGLQFQLALETLQQLERVRSDAVKGLTMQQLAQLLRVDALQLEPVLETLSELDWIGL LNEEFKGEAARYVMLANPDATALAPLLDTLLLRREESTQNLWEKGRWPLLNVRDVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rfer_2991 |
Synonyms | Rfer_2991; UPF0761 membrane protein Rfer_2991 |
UniProt ID | Q21U51 |
◆ Native Proteins | ||
PLC-30 | Active Native Phospholipase C | +Inquiry |
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
IgG-012L | Native Llama Ig fraction | +Inquiry |
Lectin-1768D | Active Native Datura Stramonium Lectin Protein | +Inquiry |
H3N2-02I | Active Native IAV H3N2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Esophagus-119H | Human Esophagus Liver Cirrhosis Lysate | +Inquiry |
PLTP-2065HCL | Recombinant Human PLTP cell lysate | +Inquiry |
LETM1-982HCL | Recombinant Human LETM1 cell lysate | +Inquiry |
DFNA5-6966HCL | Recombinant Human DFNA5 293 Cell Lysate | +Inquiry |
INSIG1-5193HCL | Recombinant Human INSIG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Rfer_2991 Products
Required fields are marked with *
My Review for All Rfer_2991 Products
Required fields are marked with *
0
Inquiry Basket