Recombinant Full Length Rhodococcus Sp. Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL22446RF |
Product Overview : | Recombinant Full Length Rhodococcus sp. Prolipoprotein diacylglyceryl transferase(lgt) Protein (Q0SHZ8) (1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodococcus jostii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-359) |
Form : | Lyophilized powder |
AA Sequence : | MTSTVDVLAYIPSPPQGVWYVGPVALRAYALFIIVGIVVAIVWGDRRWVARGGEKGTVLD IAIWAVPFGLIGGRLYHVMTDWPTYFGEGGDPVDALKVWQGGLGIWGAVALGGVGAWIGC RRRGIPLPALGDAVAPAILLAQAIGRLGNYFNQELYGRETEVPWGLEIFERRNDVGQVSP QLIDGVSTGEVAFVVHPTFLYEALWNVLIVLLLVWVDRRFRIGHGRLFALYVAGYCAGRF WIELMRSDHASLIAGVRVNSFTSALVFVAALVYFFAATKGREDPAELRPADGGPVGGGGE PVDGEIAQKEPEKNVEDAGKDEGTSASEPVSDDKAASTASTGGEAGTKTIDSKKDDAND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgt |
Synonyms | lgt; RHA1_ro01011; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase |
UniProt ID | Q0SHZ8 |
◆ Recombinant Proteins | ||
LILRB1-6900H | Recombinant Human LILRB1 protein, His & T7-tagged | +Inquiry |
HTATIP2-30680TH | Recombinant Human HTATIP2, His-tagged | +Inquiry |
SNCG-6238C | Recombinant Chicken SNCG | +Inquiry |
RUVA-3663S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 RUVA protein, His-tagged | +Inquiry |
EPCAM-2939H | Recombinant Human EPCAM protein, His-tagged, Site-Specific AF 488-Labeled | +Inquiry |
◆ Native Proteins | ||
AZU1-26565TH | Native Human AZU1 | +Inquiry |
LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
IL16-29736TH | Native Human IL16 | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
IgG-514H | Native Human IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPP8-6830HCL | Recombinant Human DPP8 293 Cell Lysate | +Inquiry |
AP3S2-8807HCL | Recombinant Human AP3S2 293 Cell Lysate | +Inquiry |
EDA2R-1335MCL | Recombinant Mouse EDA2R cell lysate | +Inquiry |
OVGP1-3509HCL | Recombinant Human OVGP1 293 Cell Lysate | +Inquiry |
FAM71C-6355HCL | Recombinant Human FAM71C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lgt Products
Required fields are marked with *
My Review for All lgt Products
Required fields are marked with *
0
Inquiry Basket