Recombinant Full Length Rhodobacter Sphaeroides Sensor Histidine Kinase Regb(Regb) Protein, His-Tagged
Cat.No. : | RFL10834RF |
Product Overview : | Recombinant Full Length Rhodobacter sphaeroides Sensor histidine kinase regB(regB) Protein (P0C0Z0) (1-462aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodobacter Sphaeroides |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-462) |
Form : | Lyophilized powder |
AA Sequence : | MILGPDGILNRDTRGDWWRLRTLILLRWMAVAGQLAAIVVTDWYLGVRLPMGLCFMAVGA SVIANVIATFVFPQNRRLTEFQALMILLFDLTQLSFLLFLTGGLTNPFALLILAPVTISG VALDVRTTVILGAIAIGLLTFTAYFHLPLILADGSSLSVPRMFEFGFWLAIVIGILFLGL YSRRVAIEIRSMSDALLATQMALDREQKLTDLGGVVAAAAHELGTPLATIKLVSSELAEE LSEQPALRDDADVIREQADRCRDILRSMGRAGKDDLQMRQGPLGEVLREAAEPHVGRGKR VEFDLYPSRGGDERQPVILRRPEVIHGVRNLIQNAVDFARSTVWIDGEWTGDRIAIRIVD DGEGYPPAIIGRIGDPFVRQRRAEESQSRRPGYEGMGLGLFIAKTLLERSGAELSFANAA DPFLRSHERPERCGAIVEVIWPVDRLVVVRNAPLGENVLIQT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | regB |
Synonyms | regB; prrB; Sensor histidine kinase RegB; Protein PrrB |
UniProt ID | P0C0Z0 |
◆ Native Proteins | ||
Immunoglobulin G-038S | Native Sheep Immunoglobulin G Protein | +Inquiry |
FGB-928P | Native Porcine Fibrinogen Protein | +Inquiry |
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
TF-71R | Native Rat Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCO2-2025HCL | Recombinant Human SCO2 293 Cell Lysate | +Inquiry |
EREG-1871MCL | Recombinant Mouse EREG cell lysate | +Inquiry |
MYL12A-4030HCL | Recombinant Human MYL12A 293 Cell Lysate | +Inquiry |
GUCY1B3-5676HCL | Recombinant Human GUCY1B3 293 Cell Lysate | +Inquiry |
PPP1R2P3-1401HCL | Recombinant Human PPP1R2P3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All regB Products
Required fields are marked with *
My Review for All regB Products
Required fields are marked with *
0
Inquiry Basket