Recombinant Full Length Rhodobacter Capsulatus Cobalt Transport Protein Cbin(Cbin) Protein, His-Tagged
Cat.No. : | RFL29394RF |
Product Overview : | Recombinant Full Length Rhodobacter capsulatus Cobalt transport protein CbiN(cbiN) Protein (O68104) (1-103aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodobacter capsulatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-103) |
Form : | Lyophilized powder |
AA Sequence : | MSSKRTLWLLAGTVALVVVPLLMGGEFGGADGQAAELIEATVPGFAPWADPLWEPPSGEV ESLFFALQAALGAFVVGLVIGRRQGAAKTREQNAPAPRSFPAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cbiN |
Synonyms | cbiN; RCAP_rcc02036; Cobalt transport protein CbiN; Energy-coupling factor transporter probable substrate-capture protein CbiN |
UniProt ID | O68104 |
◆ Recombinant Proteins | ||
NELL1-29225TH | Recombinant Human NELL1 | +Inquiry |
Cldn9-2180M | Recombinant Mouse Cldn9 Protein, Myc/DDK-tagged | +Inquiry |
KCNE1-382C | Recombinant Cynomolgus Monkey KCNE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VTI1A-571H | Recombinant Human VTI1A Protein, MYC/DDK-tagged | +Inquiry |
RRP36-7819M | Recombinant Mouse RRP36 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
AMY1B-31376TH | Native Human AMY1B | +Inquiry |
FN1-2708H | Native Human FN1 protein | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
Collagen-319H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH8A1-8914HCL | Recombinant Human ALDH8A1 293 Cell Lysate | +Inquiry |
HLA-B-5495HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
AMTN-001HCL | Recombinant Human AMTN cell lysate | +Inquiry |
MRPL4-4172HCL | Recombinant Human MRPL4 293 Cell Lysate | +Inquiry |
FMNL1-658HCL | Recombinant Human FMNL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cbiN Products
Required fields are marked with *
My Review for All cbiN Products
Required fields are marked with *
0
Inquiry Basket