Recombinant Full Length Rhizobium Sp. Uncharacterized Zinc Protease Y4Wa (Ngr_A01040) Protein, His-Tagged
Cat.No. : | RFL23306SF |
Product Overview : | Recombinant Full Length Rhizobium sp. Uncharacterized zinc protease y4wA (NGR_a01040) Protein (P55679) (1-512aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium fredii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-512) |
Form : | Lyophilized powder |
AA Sequence : | MSEPFFRPGSGPAPGHPTAEPWRRRKRWYSPSDGRAGTARSHLPQRSTSHDGVCSRICAF VLCMVALQFLMTSAMAADESPLREAEVANFMLGNGMEVVVIPDHRAPIVTQMIWYKVGNA DEPPGKSGIAHFLEHLMFKGTKKHPSGEFSAKIAEIGGEENAFTGSDYTAYHQTVTPESL RTMMEFEADRMRHLVLTDAVIVPERDVILEERRWRVENDPEQLLEEEMQATLYQNHPYRI PTIGWMHEMEQLNREDALKFYDRYYAPNNAILVVAGDVDAGRVRQLADETFGTLPRGPDL PARVRPQEPEQNTKRIVALTDPRVTVPSFQKSWVTTSYGTAEQGEAEALDILSEILGGGT RSRIYQELVVKQAIASSGGAYFNGRSLDPSSFTVFGSPRGEAKIEEVEDAIDAEIRKIIE FGITDVELEKAKNRFVRSIIFARDSQSGMAGIYGAALATGDTAHDVEAWPLRIRAVKAAE VQAAARKYLSPDRSVAGYLLPRESATSGDKSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NGR_a01040 |
Synonyms | NGR_a01040; y4wA; Uncharacterized zinc protease y4wA |
UniProt ID | P55679 |
◆ Recombinant Proteins | ||
RFL997SF | Recombinant Full Length Shewanella Pealeana Protease Htpx(Htpx) Protein, His-Tagged | +Inquiry |
OLFR147-6346M | Recombinant Mouse OLFR147 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGS1-6072H | Recombinant Human PTGS1 Protein (Gly367-Leu599), N-His tagged | +Inquiry |
YUTM-4015B | Recombinant Bacillus subtilis YUTM protein, His-tagged | +Inquiry |
EFCAB2-5011M | Recombinant Mouse EFCAB2 Protein | +Inquiry |
◆ Native Proteins | ||
a-acid glycoprotein-003H | Native Human a-acid glycoprotein Protein | +Inquiry |
MPOB-234H | Native Human Myeloperoxidase Isoform B | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
PLD-18A | Active Native Arachis hypogaea (peanut) Phospholipase D, Type II | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSDMA-5727HCL | Recombinant Human GSDMA 293 Cell Lysate | +Inquiry |
IFIT3-5286HCL | Recombinant Human IFIT3 293 Cell Lysate | +Inquiry |
RNF133-1518HCL | Recombinant Human RNF133 cell lysate | +Inquiry |
SLC22A8-1790HCL | Recombinant Human SLC22A8 293 Cell Lysate | +Inquiry |
COX6B2-7328HCL | Recombinant Human COX6B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGR_a01040 Products
Required fields are marked with *
My Review for All NGR_a01040 Products
Required fields are marked with *
0
Inquiry Basket