Recombinant Full Length Rhizobium Sp. Uncharacterized Protein Y4Ii (Ngr_A03240) Protein, His-Tagged
Cat.No. : | RFL4129SF |
Product Overview : | Recombinant Full Length Rhizobium sp. Uncharacterized protein y4iI (NGR_a03240) Protein (P55492) (1-703aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium fredii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-703) |
Form : | Lyophilized powder |
AA Sequence : | MRRRSTEGTVMTDGSKPTFEIGIAMSGAISAGAYSAGVFDFLIQALDAWEKAKAEGAPDL PEYDVRLKALSGASAGAITAAIGVIAAGGREAPATFPSPAPGSQNIRFTLGRLYRSWVTS PTLVSPDGSPDLLSLEDLAGGRPVISVLNANVLTAIGAEALEATGTLSPRAYVASSLHLY MMLSNLRGVPYAIHFNGGQYNMMTHADRVHYVVEGIGTWKPTPSPFADTDSGTSIAATSL FGAAGASTRPPEWLAFANAALASGAFPIGLSPRVIATATSQYAKAKFPISEDQSELRPIP TWPDAWHVSASQDYPFSFVSVDGGLINNDPFEFVRFTLMKDPPRPNERNAEKADRAVIMI APFPEGPPFLGDGEPPLGVLSIARRVVTALRQQVRFKPDQLLAVAAEGTHSRFMISPHRV PPSTPGGEEREETFSIASGLLGGFGGFVLEAFRDHDYQLGRRNCQYFLMRHLTIDKNHQT LHWPEGAAERRNAVISKTLSDGSMHDYVPIIPLVGDALPEVPYPRWARIDENAFALLVKR IEARLVAVARRLVSTETTSARMKLGLNFLLLVGRNRIVDYIRLTLLQELVMRDQIEGWPL PAADLRPDFVRAVLAALLDPAFDLRTEAGIARTTKLDTSLVREILSTLAGAAGANCQVWL APWTRTDEPSLYTLVSRRPSFLATLLQGRSPARLFAKPVVDRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NGR_a03240 |
Synonyms | NGR_a03240; y4iI; Uncharacterized protein y4iI |
UniProt ID | P55492 |
◆ Recombinant Proteins | ||
RFL9512SF | Recombinant Full Length Salmonella Paratyphi C Upf0283 Membrane Protein Ycjf(Ycjf) Protein, His-Tagged | +Inquiry |
FBXL8-5059C | Recombinant Chicken FBXL8 | +Inquiry |
PDCD1LG2-375H | Active Recombinant Human PDCD1LG2 protein, mFc-tagged | +Inquiry |
SCO3037-1226S | Recombinant Streptomyces coelicolor A3(2) SCO3037 protein, His-tagged | +Inquiry |
CAP1-10696H | Recombinant Human CAP1, His-tagged | +Inquiry |
◆ Native Proteins | ||
CVB1-12 | Native Coxsackievirus B1 Antigen | +Inquiry |
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
B. afzelii-21 | Native Borrelia afzelii Antigen | +Inquiry |
Collagen-45R | Native Rat Collagen I | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL7-766CCL | Recombinant Cynomolgus ANGPTL7 cell lysate | +Inquiry |
TFAP4-1137HCL | Recombinant Human TFAP4 293 Cell Lysate | +Inquiry |
ZNF18-133HCL | Recombinant Human ZNF18 293 Cell Lysate | +Inquiry |
ZBTB26-1953HCL | Recombinant Human ZBTB26 cell lysate | +Inquiry |
CCL6-1896MCL | Recombinant Mouse CCL6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGR_a03240 Products
Required fields are marked with *
My Review for All NGR_a03240 Products
Required fields are marked with *
0
Inquiry Basket