Recombinant Full Length Rhizobium Sp. Uncharacterized Hth-Type Transcriptional Regulator Y4Fk (Ngr_A03710) Protein, His-Tagged
Cat.No. : | RFL14051SF |
Product Overview : | Recombinant Full Length Rhizobium sp. Uncharacterized HTH-type transcriptional regulator y4fK (NGR_a03710) Protein (P55449) (1-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium fredii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-427) |
Form : | Lyophilized powder |
AA Sequence : | MQIDARHGSADKTSHQVMPLPFGKLVLCLLVAGTIAALIAVLLYPPLNPLALFSMLDWNL IAAAEPLVRQCGSLPLLDKFPSLGWNTVLFCATLPSTDEPLRTDSFVAHTRDTILANLGS VEPNWRWKVSSETPEACSLAYHRQRVLSAWLASAEHSVCLQALARRDTRLISFYFVLSGH IEITDRRTRKTLSISPNHVASARERAGNRMTIQSESSWLAFHIPESALRRSFEDLTGRPY VHEFVLPATCFSQDDVQGLYQTLRQAERDLNSAASKAMPLLAKAYKQLALVKLFSTMPHN LAEAFCQGTSGAAPRQLLKAEAFMRENLTNPVTIEDLAAAARCTPRALQRMFRTYRGGSP MSVLCNYRLAAAHGAIKAGRAGSITELALNLQFSNPGRFSVLYKSAYGLSPSSALRFTRN EGSVEQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NGR_a03710 |
Synonyms | NGR_a03710; y4fK; Uncharacterized HTH-type transcriptional regulator y4fK |
UniProt ID | P55449 |
◆ Native Proteins | ||
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
CAT-26409TH | Native Human CAT | +Inquiry |
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
Cry1Ac-524 | Native Bacillus thuringiensis Cry1Ac Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGA-784HCL | Recombinant Human AGA cell lysate | +Inquiry |
INPP5B-861HCL | Recombinant Human INPP5B cell lysate | +Inquiry |
DAG1-7082HCL | Recombinant Human DAG1 293 Cell Lysate | +Inquiry |
SPATA6L-261HCL | Recombinant Human SPATA6L cell lysate | +Inquiry |
TBXA2R-1197HCL | Recombinant Human TBXA2R 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGR_a03710 Products
Required fields are marked with *
My Review for All NGR_a03710 Products
Required fields are marked with *
0
Inquiry Basket