Recombinant Full Length Rhizobium Sp. Probable Peptide Abc Transporter Permease Protein Y4Tp(Ngr_A01430) Protein, His-Tagged
Cat.No. : | RFL8662SF |
Product Overview : | Recombinant Full Length Rhizobium sp. Probable peptide ABC transporter permease protein y4tP(NGR_a01430) Protein (Q53191) (1-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium fredii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-313) |
Form : | Lyophilized powder |
AA Sequence : | MGVYILRRLVSTIAVMAMVGIFIFLLLRLAPGDPAAVIAGPTATEQMVANIREELGLNEP LPVQFVHWASDVLRGNFGASVFTGVPVLQLLSQRLEPTISLSVLTMILSVTVGVSFGVLA AWRSGGFVDRALATFSAIGYSVPVFVIGYILIYFFAIQTRWLPVQGYTSINQGVAPWFLH LILPTVTLSVPYIAFIARITRGSMLEVLSEDYMRTAAAKGASPFAMLFHHALKNAGVPIL TVIGISFAYMIGGVVLTETVFNVPGIGRLVVDAIKNRDYPIIQTVLVLISGLYVLINLLV DLAYTLIDPRIRY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NGR_a01430 |
Synonyms | NGR_a01430; y4tP; Probable peptide ABC transporter permease protein y4tP |
UniProt ID | Q53191 |
◆ Recombinant Proteins | ||
fanC-1206E | Recombinant E. coli K99 Fimbrial Protein, His-SUMO-tagged | +Inquiry |
RASGEF1B-2189H | Recombinant Human RASGEF1B, GST-tagged | +Inquiry |
RFL809CF | Recombinant Full Length Uncharacterized Protein C18B2.1(C18B2.1) Protein, His-Tagged | +Inquiry |
FGFR1-1348H | Recombinant Human FGFR1 protein(Ala1-Lys221), hFc-tagged | +Inquiry |
IL9-8866H | Active Recombinant Human IL9,His-tagged | +Inquiry |
◆ Native Proteins | ||
HBsAg-321H | Active Native Hepatitis B Surface Ag Subtype Ad Protein | +Inquiry |
IgG-340G | Native Goat IgG | +Inquiry |
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
Pa-27F | Native Feline Parvovirus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB5C-524HCL | Recombinant Human RAB5C lysate | +Inquiry |
NUSAP1-1236HCL | Recombinant Human NUSAP1 cell lysate | +Inquiry |
Esophagus-560M | MiniPig Esophagus Lysate, Total Protein | +Inquiry |
CST11-7228HCL | Recombinant Human CST11 293 Cell Lysate | +Inquiry |
MAGEC2-4541HCL | Recombinant Human MAGEC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGR_a01430 Products
Required fields are marked with *
My Review for All NGR_a01430 Products
Required fields are marked with *
0
Inquiry Basket