Recombinant E. coli K99 Fimbrial Protein, His-SUMO-tagged

• Cat.No.: fanC-1206E
• Product Overview: Recombinant E. coli K99 Fimbrial Protein (23-181aa) was expressed in E. coli with N-terminal His-SUMO-tag.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 23-181 a.a.
• Description: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.
  FanC is the main component of the K99 fimbriae.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 32.5 kDa
• AA Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGS
  MNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSN
  GGYKAGVFTTSASFLVTYM
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: K99 fimbrial protein
• Official Symbol: K99 fimbrial protein
• Synonyms: K99 fimbrial protein; fanC
• UniProt ID: P18103