Recombinant Full Length Rhizobium Sp. Nodulation Protein Nolw(Nolw) Protein, His-Tagged
Cat.No. : | RFL12365SF |
Product Overview : | Recombinant Full Length Rhizobium sp. Nodulation protein nolW(nolW) Protein (P55712) (1-234aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium fredii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-234) |
Form : | Lyophilized powder |
AA Sequence : | MPTTPIPFTPLHMFRRLLCVGLFLFAGIHTTLGATLPLPSTSYKYTVLDQDLSAALQEFG NNLKISVNISAEVKGRIRGRIPELSPREFLDRLTDLYDLQWYYDGVVLYVSAAKEAQTRM LVLSSVHFSAFKLALDKLDISDERYPVRPAPGNGLVLVSGPPRFMALIEQTLNGLLAVAQ AQPRATDTPARESVMVLFRGSSTTVVRGGRPEVFYTSEMLPENDDGGKAELSKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nolW |
Synonyms | nolW; NGR_a00690; y4yD; Nodulation protein NolW |
UniProt ID | P55712 |
◆ Recombinant Proteins | ||
Mylk4-8035M | Recombinant Mouse Mylk4 protein, His & T7-tagged | +Inquiry |
REG3A-3417H | Recombinant Human REG3A protein, GST-tagged | +Inquiry |
ALAD-292C | Recombinant Cynomolgus ALAD Protein, His-tagged | +Inquiry |
ORM2-264H | Recombinant Human orosomucoid 2, His-tagged | +Inquiry |
DNAAF1-9858Z | Recombinant Zebrafish DNAAF1 | +Inquiry |
◆ Native Proteins | ||
SNCA-27341TH | Native Human SNCA | +Inquiry |
HSV1Ag-354H | Active Native Herpes Simplex Virus 1 Protein | +Inquiry |
LEL/LEA-070TB | Native Tomato Lycopersicon esculentum Lectin (LEL/LEA) | +Inquiry |
CTRC-27191TH | Native Human CTRC | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN1-810HCL | Recombinant Human TSPAN1 cell lysate | +Inquiry |
CDK17-7632HCL | Recombinant Human CDK17 293 Cell Lysate | +Inquiry |
TMEM161A-678HCL | Recombinant Human TMEM161A lysate | +Inquiry |
MMADHC-4283HCL | Recombinant Human MMADHC 293 Cell Lysate | +Inquiry |
SNCG-1654HCL | Recombinant Human SNCG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nolW Products
Required fields are marked with *
My Review for All nolW Products
Required fields are marked with *
0
Inquiry Basket